BYKdb

Annotate results for A0A151JI71

A0A151JI71 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A151JI71
DOMAINtad19/260DEIDLGKLLGILLDAKWFIFAITFIFAVGGVAVALLSTPIYKADALLQIEEKSKGGIGSL
IGGDMGELFSQESTATTEIEILKSRMILGDTVDKFNLTTVTEAKYFPLVGKGLARMAGKV
NQIEVSRYQVPDYAQDMGHTLVVTDEAQQSYQLVREDDTVVLQGKAGELAKNDGYELFVT
ELRSHTGQEFAIGQRSRLEAIEWLKENLAISERGKQTGILQLSFEGENRKQISEILNHIS
QT
DOMAINcd539/726SGPAPGIGKSFISTNFAAVAAKTGQKVLIIDADMRKGYLQQCFGLKWENGLSDYLAGKID
TATAVQHAKVDNLDIITRGQVPPNPSELLMHPRFKQLVEWASENYDLVIIDTPPVLAVTD
PSIVGSLAGTTLMVARFGQNTVKEIEVARNRFEQAGIEVKGVILNATEKRASSYYGYGYY
NYSYGESK
SITEWalker A546/548GKS
SITEWalker A'566/573LIIDADMR
SITEWalker B646/652VIIDTPP
SITEY Cluster712/722YYGYGYYNYSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MYETMTTPQTRPSVDNASDEIDLGKLLGILLDAKWFIFAITFIFAVGGVAVALLSTPIYKADALLQIEEKSKGGIGSLIG
                  DEIDLGKLLGILLDAKWFIFAITFIFAVGGVAVALLSTPIYKADALLQIEEKSKGGIGSLIG

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GDMGELFSQESTATTEIEILKSRMILGDTVDKFNLTTVTEAKYFPLVGKGLARMAGKVNQIEVSRYQVPDYAQDMGHTLV
GDMGELFSQESTATTEIEILKSRMILGDTVDKFNLTTVTEAKYFPLVGKGLARMAGKVNQIEVSRYQVPDYAQDMGHTLV

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VTDEAQQSYQLVREDDTVVLQGKAGELAKNDGYELFVTELRSHTGQEFAIGQRSRLEAIEWLKENLAISERGKQTGILQL
VTDEAQQSYQLVREDDTVVLQGKAGELAKNDGYELFVTELRSHTGQEFAIGQRSRLEAIEWLKENLAISERGKQTGILQL

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SFEGENRKQISEILNHISQTYFLQNVERNSAEAEKSLTFLKGHLPDIKDSLTAAEDSLNRFRQENESIDLGLEAKSTLDV
SFEGENRKQISEILNHISQT                                                            

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MVKLEAQLNELTFKESEISQRFTKDHPAYISLLDKRQTLLKERERLNQQVQKLPKTQREVLRMTRDVEVNQQIYIQLLNK


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VQELSIIKAGTVGNVRILDEAQTFAKPIKPKKPLIAVLATLLGGMLSVAIVLVKAALHRGVETPDQIEQIGLSVYASVPK


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
STLQIALAEKLKRKGKHNKDLALLSESNPADLSIEALRGLRTSLHFAMLEAKNNVVMISGPAPGIGKSFISTNFAAVAAK
                                                          SGPAPGIGKSFISTNFAAVAAK
                                                                 GKS            
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TGQKVLIIDADMRKGYLQQCFGLKWENGLSDYLAGKIDTATAVQHAKVDNLDIITRGQVPPNPSELLMHPRFKQLVEWAS
TGQKVLIIDADMRKGYLQQCFGLKWENGLSDYLAGKIDTATAVQHAKVDNLDIITRGQVPPNPSELLMHPRFKQLVEWAS
     LIIDADMR                                                                   
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ENYDLVIIDTPPVLAVTDPSIVGSLAGTTLMVARFGQNTVKEIEVARNRFEQAGIEVKGVILNATEKRASSYYGYGYYNY
ENYDLVIIDTPPVLAVTDPSIVGSLAGTTLMVARFGQNTVKEIEVARNRFEQAGIEVKGVILNATEKRASSYYGYGYYNY
     VIIDTPP                                                           YYGYGYYNY
        
....:...
SYGESKKV
SYGESK  
SY      

© 1998-2019