BYKdb

Annotate results for A0A151QJG5

A0A151QJG5 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A151QJG5
DOMAINtad26/285GEINLLDLWYNLLDFKWVAAAIVAVATAIGLLYATVATPIYSADVLLQVETKQTGGLAAL
EDVSGVLAAGGSNVTGELEIIKSRTVVESVAQTLGLAQSITPQYFPVFGQWLANQHEAAL
GLAQPFMGLNQYAWGGEQLKLAQFSVPTEFTDQAFVAVKGEGNTFSLYSPFEEPLGQGTV
GQPLTFKIGYGSGSITISQFEANPGMQANVVRRHPLSLHNGLVAPLTAGEVGRNSSMIRV
SYESPNPAFAVQFLNELANA
DOMAINcd562/754TGPVPEIGKSFVSANFAAIMAQAGKRVLLIDGDMRKGTLSRYFIQEERGDAKHPGLSDVV
AGTVGFDKALIKTELEGLHVLVSGSVPPNPSELLLHPNFIALLEKADVEYDYVIIDSPPV
LLVSDASVMGQHCSATFIVARYGASNVRQVSDSQKRLAQAGVRVNGLIFNGFIANRSGYY
YGYGYGYGYKNAY
SITEWalker A569/571GKS
SITEWalker A'589/596LLIDGDMR
SITEWalker B674/680VIIDSPP
SITE-671/-673YDY
SITEY Cluster740/757YYYGYGYGYGYKNAYGTY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPFENTRNGGTFQSAAAHPELAQESGEINLLDLWYNLLDFKWVAAAIVAVATAIGLLYATVATPIYSADVLLQVETKQTG
                         GEINLLDLWYNLLDFKWVAAAIVAVATAIGLLYATVATPIYSADVLLQVETKQTG

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GLAALEDVSGVLAAGGSNVTGELEIIKSRTVVESVAQTLGLAQSITPQYFPVFGQWLANQHEAALGLAQPFMGLNQYAWG
GLAALEDVSGVLAAGGSNVTGELEIIKSRTVVESVAQTLGLAQSITPQYFPVFGQWLANQHEAALGLAQPFMGLNQYAWG

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GEQLKLAQFSVPTEFTDQAFVAVKGEGNTFSLYSPFEEPLGQGTVGQPLTFKIGYGSGSITISQFEANPGMQANVVRRHP
GEQLKLAQFSVPTEFTDQAFVAVKGEGNTFSLYSPFEEPLGQGTVGQPLTFKIGYGSGSITISQFEANPGMQANVVRRHP

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LSLHNGLVAPLTAGEVGRNSSMIRVSYESPNPAFAVQFLNELANAYLRQNVERKGQEAEQQLVFLDEQLPSIKEQLRKAE
LSLHNGLVAPLTAGEVGRNSSMIRVSYESPNPAFAVQFLNELANA                                   

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EALNNFVQSKGTIDPTLDTQRILTQDVALETKKVELNLEREKLLQRFQPGHPLIQAIDDQLAQLRSVRGGVASQTQALPE


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VQQEYLRLRRDVEVNQALYTSLLNGAQQLKVAKAGTVGNVAIVDYAQQPKRPFKPNKGQVVALAVLAGIFLGVLAAQALA


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLRSAVRDPSKLEQATGLSVYSIVPLSQQQTAAEKGLRRRTDKVGLLAVSAPNDPSIEALRSFRTGLQFATIDSPNKRVL


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ITGPVPEIGKSFVSANFAAIMAQAGKRVLLIDGDMRKGTLSRYFIQEERGDAKHPGLSDVVAGTVGFDKALIKTELEGLH
 TGPVPEIGKSFVSANFAAIMAQAGKRVLLIDGDMRKGTLSRYFIQEERGDAKHPGLSDVVAGTVGFDKALIKTELEGLH
        GKS                 LLIDGDMR                                            
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLVSGSVPPNPSELLLHPNFIALLEKADVEYDYVIIDSPPVLLVSDASVMGQHCSATFIVARYGASNVRQVSDSQKRLAQ
VLVSGSVPPNPSELLLHPNFIALLEKADVEYDYVIIDSPPVLLVSDASVMGQHCSATFIVARYGASNVRQVSDSQKRLAQ
                                 VIIDSPP                                        
       730       740       750       760      
....:....|....:....|....:....|....:....|....:.
AGVRVNGLIFNGFIANRSGYYYGYGYGYGYKNAYGTYGDPVQGKKA
AGVRVNGLIFNGFIANRSGYYYGYGYGYGYKNAY            
                   YYYGYGYGYGYKNAYGTY         

© 1998-2019