BYKdb

Annotate results for A0A154IJJ3

A0A154IJJ3 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A154IJJ3
DOMAINtad30/205DEIDLTSGLRLIRRRMVMIMAIIMVFMAVAATVISGLKPTYRAESRLIIHTPLATKLGTD
ESGRNDPLDATSETERLLSRSIAERVIRDLRLNEWPEFNPALQEISPIDKIRSMLRGWVD
SEKPSLPIRDSIEPIIPKYYKALRVWRDGQGDVIQIGFDASDPERAASVPNRLISI
DOMAINcd545/730TSAHSGEGKSLVARSLAIDLAANGIPVLLVDGDLRLGNLDSFFKSELKQGLNEFLCGQAG
MRDIIHHHPSGIDFIPAGNAGLHRRVRLTDAADIVAMAASQGQIVIFDSAPVLASADTMH
LTALAERTLVVVKWGKTSRRAVEFCLHQLKTARNAEIAVAINNVNPKQHAMYNFSDSELF
VNSLRK
SITE-679/-681GKT
SITEWalker A'572/579LLVDGDLR
SITEWalker B649/655VIFDSAP
SITEY Cluster731/734YHEY
SITEWalker A552/554GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTISTVPPDRNPSLSSMRYDPRLQVETRSDEIDLTSGLRLIRRRMVMIMAIIMVFMAVAATVISGLKPTYRAESRLIIHT
                             DEIDLTSGLRLIRRRMVMIMAIIMVFMAVAATVISGLKPTYRAESRLIIHT

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PLATKLGTDESGRNDPLDATSETERLLSRSIAERVIRDLRLNEWPEFNPALQEISPIDKIRSMLRGWVDSEKPSLPIRDS
PLATKLGTDESGRNDPLDATSETERLLSRSIAERVIRDLRLNEWPEFNPALQEISPIDKIRSMLRGWVDSEKPSLPIRDS

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IEPIIPKYYKALRVWRDGQGDVIQIGFDASDPERAASVPNRLISIYLEERKDSLRGRVDAAEEWLLLRIDEQMGRAKAAR
IEPIIPKYYKALRVWRDGQGDVIQIGFDASDPERAASVPNRLISI                                   

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DAADVYQKTTDVASNDDDQVEQIKSIMELGERRTKIEQGRAEARATISALEAADDPSLVLQNMVIPDSIVAMQRELRAKE


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QDLERLLETYGNTAEAVVDARAKILKTRTDLSLATDRYLQSIHAKLAALDHEDDAIRSALATAHEKRTRSALAQTELARL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QRMADKEQTALDKLEEQRRGLAAQAMLPGAELEVLSPAAVPLAPQGRGRLFYLIGALLASISIGVTAAFVVEMLDNSVRS


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FDQMSGMSRIVPAGFIPHLKRKDRRDPSMLFGSIQDGMFDEAIRSVMTSLKQSNGGKLPNSIVVTSAHSGEGKSLVARSL
                                                                TSAHSGEGKSLVARSL
                                                                       GKS      
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AIDLAANGIPVLLVDGDLRLGNLDSFFKSELKQGLNEFLCGQAGMRDIIHHHPSGIDFIPAGNAGLHRRVRLTDAADIVA
AIDLAANGIPVLLVDGDLRLGNLDSFFKSELKQGLNEFLCGQAGMRDIIHHHPSGIDFIPAGNAGLHRRVRLTDAADIVA
           LLVDGDLR                                                             
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAASQGQIVIFDSAPVLASADTMHLTALAERTLVVVKWGKTSRRAVEFCLHQLKTARNAEIAVAINNVNPKQHAMYNFSD
MAASQGQIVIFDSAPVLASADTMHLTALAERTLVVVKWGKTSRRAVEFCLHQLKTARNAEIAVAINNVNPKQHAMYNFSD
        VIFDSAP                                                                 
       730     
....:....|....:
SELFVNSLRKYHEYT
SELFVNSLRK     
          YHEY 

© 1998-2019