BYKdb

Annotate results for A0A154VE85

A0A154VE85 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A154VE85
DOMAINtad21/210PADAPMPLRRGLSRNKPLFAISFLALAGLGLAIVAGLPERYRATAQLVFQDRSSGFGGSA
LLLDRGAIETEAAIVASRDLALRAVESLRLIDDPAFNPALQPSASFAFGAWLRDHVLAPL
GVAPSSGSGRASQGSAVIAPPPAVLAERAVDAYLDRLSVSPADNARIVAVDFTAADPDLA
AAAANRTAGL
DOMAINcd564/752TSSIAGEGKTATAVSLAALAAKAGRKVLLIDADLRDPGIGPALYFPHERGLATYLAGAAS
AEAVTEFHLACGIYFIPAGPAGDDPSALLSAPAMQTLLQQKAGEFDLVVIDSPPVLPVSD
ALILSRLVDATLYVVAAESVRRDAVRAGLQALRQAGAAVAGTVLTRLDPRRQPPEDAARY
AYAAPASGQ
SITEWalker A571/573GKT
SITEWalker A'591/598LLIDADLR
SITEWalker B671/677VVIDSPP
SITEY Cluster743/745YAY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSALAPLQPNPAARAGMAPSPADAPMPLRRGLSRNKPLFAISFLALAGLGLAIVAGLPERYRATAQLVFQDRSSGFGGSA
                    PADAPMPLRRGLSRNKPLFAISFLALAGLGLAIVAGLPERYRATAQLVFQDRSSGFGGSA

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLLDRGAIETEAAIVASRDLALRAVESLRLIDDPAFNPALQPSASFAFGAWLRDHVLAPLGVAPSSGSGRASQGSAVIAP
LLLDRGAIETEAAIVASRDLALRAVESLRLIDDPAFNPALQPSASFAFGAWLRDHVLAPLGVAPSSGSGRASQGSAVIAP

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PPAVLAERAVDAYLDRLSVSPADNARIVAVDFTAADPDLAAAAANRTAGLYVEDRVAQRAAAARRADEWLGGRLERLREE
PPAVLAERAVDAYLDRLSVSPADNARIVAVDFTAADPDLAAAAANRTAGL                              

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AAAAQQRLDAYRRETGMLEIGGGSIYRDQLTQVNAQLVAARGSRTEAEARAAQARRLIGQGSNTGTNTGGGLETAAAVLN


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ADLVRELRLQEAALQRRIAELRVEYRDDHPRLQEALSESEGLRRTIAGEVEKIGIGLANEVEVARARERALQQEVDRLQV


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LVDDRNDALLSLRALEGDLRSRTQLYEVMLARFNEAKLQDERLVGPEARVISAAVPPAEPLFPGKAVLAVLAVLVAAVLA


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AGIAMLRERLRKGYGSVRQVERSTGLPVLGALPALSRASLRGMQPHELALDDPAAAYAEAVRGLRTGLLLAAAGDRPVRT


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLVTSSIAGEGKTATAVSLAALAAKAGRKVLLIDADLRDPGIGPALYFPHERGLATYLAGAASAEAVTEFHLACGIYFIP
   TSSIAGEGKTATAVSLAALAAKAGRKVLLIDADLRDPGIGPALYFPHERGLATYLAGAASAEAVTEFHLACGIYFIP
          GKT                 LLIDADLR                                          
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AGPAGDDPSALLSAPAMQTLLQQKAGEFDLVVIDSPPVLPVSDALILSRLVDATLYVVAAESVRRDAVRAGLQALRQAGA
AGPAGDDPSALLSAPAMQTLLQQKAGEFDLVVIDSPPVLPVSDALILSRLVDATLYVVAAESVRRDAVRAGLQALRQAGA
                              VVIDSPP                                           
       730       740       750       760   
....:....|....:....|....:....|....:....|...
AVAGTVLTRLDPRRQPPEDAARYAYAAPASGQTAIEERRRIAG
AVAGTVLTRLDPRRQPPEDAARYAYAAPASGQ           
                      YAY                  

© 1998-2019