BYKdb

Annotate results for A0A157ZCE8

A0A157ZCE8 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A157ZCE8
DOMAINtad13/271AELDVIAVIDTLLKNAWRIVLIMAVVALAGTAWAFLWPPKYQADIMIQVEDSADGGVTGS
VLNEISTLFDVKSSAAAEAQIITSRLVVSRAVEKRRLYIDVTPKRFPVVGDFISRVYEKP
IRPGVFGLGGFAWGQERAELSRFDVPKPLLEEPFTLSVEDAGHYTLTNSYLDLPVRGTVG
LESKVNTLYGPLAINVTRFDALPGTHFSVVRHSLDDTVNKLQARLDVQEKVKQSGVIVAT
LLGRDAERTSLTLQEIGEQ
DOMAINcd549/738TGAAPDVGKSFISANLGTVLAAMGQRVLVIDGDLRRPSLNPCFGVARGPGWSDLIVGKAA
LEQVLHPIPSPRLDFIAAGSSVSNPSELLASPHAAALIDALRGAYDYVLVDTPPVLAVDD
AASFAAQAHTVLLVARAGKTRVGELNEAMKRLGLGGSKPAAVVLNGLPSRSVRAAYGSQG
YRSYDYGAPA
SITEWalker A556/558GKS
SITEWalker A'576/583LVIDGDLR
SITEWalker B656/662VLVDTPP
SITE-653/-655YDY
SITE-686/-688GKT
SITEY Cluster724/734YGSQGYRSYDY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSHPDRHSPVQAAELDVIAVIDTLLKNAWRIVLIMAVVALAGTAWAFLWPPKYQADIMIQVEDSADGGVTGSVLNEISTL
            AELDVIAVIDTLLKNAWRIVLIMAVVALAGTAWAFLWPPKYQADIMIQVEDSADGGVTGSVLNEISTL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FDVKSSAAAEAQIITSRLVVSRAVEKRRLYIDVTPKRFPVVGDFISRVYEKPIRPGVFGLGGFAWGQERAELSRFDVPKP
FDVKSSAAAEAQIITSRLVVSRAVEKRRLYIDVTPKRFPVVGDFISRVYEKPIRPGVFGLGGFAWGQERAELSRFDVPKP

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLEEPFTLSVEDAGHYTLTNSYLDLPVRGTVGLESKVNTLYGPLAINVTRFDALPGTHFSVVRHSLDDTVNKLQARLDVQ
LLEEPFTLSVEDAGHYTLTNSYLDLPVRGTVGLESKVNTLYGPLAINVTRFDALPGTHFSVVRHSLDDTVNKLQARLDVQ

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EKVKQSGVIVATLLGRDAERTSLTLQEIGEQYVRQNVERKYADAAQSLKFLNAQLPELKQKLEDAQARYTKLRNERSVID
EKVKQSGVIVATLLGRDAERTSLTLQEIGEQ                                                 

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LPTETTTGLQQQAEAKAQLVALQQKRAELVTRYTSMHPGVVAIDEQIGLLQKQISEFDAALGRLPNVEQDAARLMLDVKV


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DTDLYTATLNNAQQLQLVKAGKVGSVRLVDTPVIQDDPAWPKRPLVIVACVFGGLLLGIVYAFAREFLAGAVNSAEAIEC


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GTGLQVLATVPLSAAQRSLRKASVDAKYGRAHVLATDAPHDQAIEGLRSLRTALRMTMADTPGKVIVLTGAAPDVGKSFI
                                                                    TGAAPDVGKSFI
                                                                           GKS  
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SANLGTVLAAMGQRVLVIDGDLRRPSLNPCFGVARGPGWSDLIVGKAALEQVLHPIPSPRLDFIAAGSSVSNPSELLASP
SANLGTVLAAMGQRVLVIDGDLRRPSLNPCFGVARGPGWSDLIVGKAALEQVLHPIPSPRLDFIAAGSSVSNPSELLASP
               LVIDGDLR                                                         
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HAAALIDALRGAYDYVLVDTPPVLAVDDAASFAAQAHTVLLVARAGKTRVGELNEAMKRLGLGGSKPAAVVLNGLPSRSV
HAAALIDALRGAYDYVLVDTPPVLAVDDAASFAAQAHTVLLVARAGKTRVGELNEAMKRLGLGGSKPAAVVLNGLPSRSV
               VLVDTPP                                                          
       730       740       750      
....:....|....:....|....:....|....:.
RAAYGSQGYRSYDYGAPADASQSTRSARLRTWLKRK
RAAYGSQGYRSYDYGAPA                  
   YGSQGYRSYDY                      

© 1998-2019