BYKdb

Annotate results for A0A158AAY4

A0A158AAY4 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A158AAY4
DOMAINtad16/284RGDGIVDLWRSVVRHKTLLGAVTGTCCAAGVLYILLATPQYRAEALLRVQSKAGVSISSL
SDVSGSIAADGSASDESDVLTSRSVVSTAIAQTGAETVVETESYFPLVGRWMATRHAIDR
ELAPAPFGLDQYAWGGERLTPGVFDLPKAALRMKFRVVAGESGRWTLYDRNDTRLAEGRV
GETVPFQVATPEGQAPGELRIDALRARPGVSFQITKYSQQMTFDNVLQRLRTSIPPRESS
LRDPALIHLSYQADSPFEAQAMVNAIIKT
DOMAINcd609/795TGPTQGVGKSFVSSNFAYLLAETRASVLLIDADMRQGRLRHLVDGREGPGLAEVLAGTAH
VEDAIVPLGNGGLSMMDAGAEYPENPAELLTRPAFQDMMAMLRDIYDYIVIDSPPVLPVS
DALSIAMQNCDLVLLVSRADRTGARQLEETLRRLENVGAKVGGHVFNGFAPGRYGAREEY
GIRTSAR
SITEWalker A616/618GKS
SITEWalker A'636/643LLIDADMR
SITEWalker B717/723IVIDSPP
SITE-714/-716YDY
SITEY Cluster782/788YGAREEY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLSYNMRPSLTPVPHRGDGIVDLWRSVVRHKTLLGAVTGTCCAAGVLYILLATPQYRAEALLRVQSKAGVSISSLSDVSG
               RGDGIVDLWRSVVRHKTLLGAVTGTCCAAGVLYILLATPQYRAEALLRVQSKAGVSISSLSDVSG

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SIAADGSASDESDVLTSRSVVSTAIAQTGAETVVETESYFPLVGRWMATRHAIDRELAPAPFGLDQYAWGGERLTPGVFD
SIAADGSASDESDVLTSRSVVSTAIAQTGAETVVETESYFPLVGRWMATRHAIDRELAPAPFGLDQYAWGGERLTPGVFD

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LPKAALRMKFRVVAGESGRWTLYDRNDTRLAEGRVGETVPFQVATPEGQAPGELRIDALRARPGVSFQITKYSQQMTFDN
LPKAALRMKFRVVAGESGRWTLYDRNDTRLAEGRVGETVPFQVATPEGQAPGELRIDALRARPGVSFQITKYSQQMTFDN

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLQRLRTSIPPRESSLRDPALIHLSYQADSPFEAQAMVNAIIKTYQQRDIERRAAQAQTSLDFLRQRLPALKQDLERAEG
VLQRLRTSIPPRESSLRDPALIHLSYQADSPFEAQAMVNAIIKT                                    

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RLNAFRTQTGTVDMQQQNVALIARMSSLEERQTTLQLALDAAQHRYRPESDQYQSALTQLNQVKREIGEASKTAAALPTI


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QRQYVELARDVAVTTQLYTSVLTNAQQLEVAAASTPPGIAVVDWAVAPEKQSWPRQWIVLLGSIFGGLFLSTVSIYLIAL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HRRELRSPEEIDHFSQVPRLAVIARSTAQLRQDVRALTHNAAPAKLLAMTSPTDPSVEALRSLRSSVRAMLSGVPIANHP


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GFHGLNPINPLNPMNPMALSHAVGNTVTVMNPGYVADATDASGRVILFTGPTQGVGKSFVSSNFAYLLAETRASVLLIDA
                                                TGPTQGVGKSFVSSNFAYLLAETRASVLLIDA
                                                       GKS                 LLIDA
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DMRQGRLRHLVDGREGPGLAEVLAGTAHVEDAIVPLGNGGLSMMDAGAEYPENPAELLTRPAFQDMMAMLRDIYDYIVID
DMRQGRLRHLVDGREGPGLAEVLAGTAHVEDAIVPLGNGGLSMMDAGAEYPENPAELLTRPAFQDMMAMLRDIYDYIVID
DMR                                                                         IVID
       730       740       750       760       770       780       790     
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:
SPPVLPVSDALSIAMQNCDLVLLVSRADRTGARQLEETLRRLENVGAKVGGHVFNGFAPGRYGAREEYGIRTSAR
SPPVLPVSDALSIAMQNCDLVLLVSRADRTGARQLEETLRRLENVGAKVGGHVFNGFAPGRYGAREEYGIRTSAR
SPP                                                          YGAREEY       

© 1998-2019