BYKdb

Annotate results for A0A158BN24

A0A158BN24 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A158BN24
DOMAINtad16/288DELRLSDYLAAVMRDWKLVTIVMLAVIACGATYAYLATPVYKADAMIQVDEPASINNANN
TSNASNANAGIRALQAAVPQLAEAKTPTAAQIELLRSRLVIEDTVRRLNLDIDATPHALP
VVGKLAGDVFAMLKRPVPQGYLSRFAWGGEAIGVPLFDTPKELYDRKFTLVAGERGAYEL
RDPNGLIVLTGHVGEKVSGATPQGLVTLKVDTLTATPGVQFDLQRFSTITTIDRLQKRLT
VAETAVQSGIIGVSLEGSNPKQIAAIVNNIANR
DOMAINcd565/752TGSRPEAGKSFLSANLATLVASTRKRVLLIDGDMRRGDIHSHFGVRHTPGLSDVLMGADP
MDVIIPDVLPGVDLIPKGSLPSHPAELLASDRLGEILGELKQRYDLVVIDTPPVLAVTDA
TVIGRHAGTSLLVVRHGKNQVQEIGETMKRLYHGGVHMKGVLLTDVPQSKVLMGSTYAGY
YAYESIAE
SITEWalker A572/574GKS
SITEWalker A'592/599LLIDGDMR
SITEWalker B671/677VVIDTPP
SITEY Cluster741/747YAGYYAY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSMNFDTRYVDVSTGDELRLSDYLAAVMRDWKLVTIVMLAVIACGATYAYLATPVYKADAMIQVDEPASINNANNTSNAS
               DELRLSDYLAAVMRDWKLVTIVMLAVIACGATYAYLATPVYKADAMIQVDEPASINNANNTSNAS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NANAGIRALQAAVPQLAEAKTPTAAQIELLRSRLVIEDTVRRLNLDIDATPHALPVVGKLAGDVFAMLKRPVPQGYLSRF
NANAGIRALQAAVPQLAEAKTPTAAQIELLRSRLVIEDTVRRLNLDIDATPHALPVVGKLAGDVFAMLKRPVPQGYLSRF

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AWGGEAIGVPLFDTPKELYDRKFTLVAGERGAYELRDPNGLIVLTGHVGEKVSGATPQGLVTLKVDTLTATPGVQFDLQR
AWGGEAIGVPLFDTPKELYDRKFTLVAGERGAYELRDPNGLIVLTGHVGEKVSGATPQGLVTLKVDTLTATPGVQFDLQR

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FSTITTIDRLQKRLTVAETAVQSGIIGVSLEGSNPKQIAAIVNNIANRYVEQDTQKRSAEAEHTLAFLEQQLPLVKKQLD
FSTITTIDRLQKRLTVAETAVQSGIIGVSLEGSNPKQIAAIVNNIANR                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EAEQRLSAFRNKQGSVDLSEESRLLLQQIVDNKTKLADLQQQRTELSLRFTANHPSIQALDAQIAGLTAAQTRLGKNVST


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LPDTEQTALRYTRDVRSNSELYANLLNSAQQLRIAKAGQVGNVRIVDLAQAADDPIRPRRTLVILISAAIGFVLGIIAAF


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VRKSLWGGVERPEDIERQLGTRVFAIVPRSTQQLRLQRQVGMRREGLHVLAAQAPEDAAVEGIRSLRTSLQLQLGEARNN


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VVMLTGSRPEAGKSFLSANLATLVASTRKRVLLIDGDMRRGDIHSHFGVRHTPGLSDVLMGADPMDVIIPDVLPGVDLIP
    TGSRPEAGKSFLSANLATLVASTRKRVLLIDGDMRRGDIHSHFGVRHTPGLSDVLMGADPMDVIIPDVLPGVDLIP
           GKS                 LLIDGDMR                                         
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KGSLPSHPAELLASDRLGEILGELKQRYDLVVIDTPPVLAVTDATVIGRHAGTSLLVVRHGKNQVQEIGETMKRLYHGGV
KGSLPSHPAELLASDRLGEILGELKQRYDLVVIDTPPVLAVTDATVIGRHAGTSLLVVRHGKNQVQEIGETMKRLYHGGV
                              VVIDTPP                                           
       730       740       750  
....:....|....:....|....:....|..
HMKGVLLTDVPQSKVLMGSTYAGYYAYESIAE
HMKGVLLTDVPQSKVLMGSTYAGYYAYESIAE
                    YAGYYAY     

© 1998-2019