BYKdb

Annotate results for A0A158CQ31

A0A158CQ31 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A158CQ31
DOMAINtad1/256MRDTLFLMRDHVWTLLACVVGAAALAAAYAFLATPIYSADAIVRVDPTDLNALGISSQTN
TVQQQQQQSGHQATAAEIAVMQSRSVLEPVIGRFGFDVEVKPHTFPILGRVAELLAKQGH
PSSPWLGLDSFAWGGEKLRVGSLYVPPTLEEKPLELTVLDKGSYELRGPDGEIMLRGIVG
TQAKSAEGVSITINEIVARPGTQFKVVHHNTFDAIETMRRQIRVAEVTKDTGIVQISFTS
SHPILTADVANALAEQ
DOMAINcd574/761TGPSPSAGKSFVAANLAVLLAEIRLRVLLIDADMRRGNLASFFRQSNPGGLADVLGGTMH
VSDAIRSVGVPGLSFMSCGSYPSNPSELLMMPECKKTLNELSEQFDVVLVDTPPILVLTD
AAIIARQAGATILVLRSGMQSEDEISDTVRKLQRAGGNLLGSVFNAIPMRSSNWRSYGYP
SEYMRTIQ
SITEWalker A581/583GKS
SITEWalker A'601/608LLIDADMR
SITEWalker B681/687VLVDTPP
SITEY Cluster750/756YGYPSEY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MRDTLFLMRDHVWTLLACVVGAAALAAAYAFLATPIYSADAIVRVDPTDLNALGISSQTNTVQQQQQQSGHQATAAEIAV
MRDTLFLMRDHVWTLLACVVGAAALAAAYAFLATPIYSADAIVRVDPTDLNALGISSQTNTVQQQQQQSGHQATAAEIAV

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MQSRSVLEPVIGRFGFDVEVKPHTFPILGRVAELLAKQGHPSSPWLGLDSFAWGGEKLRVGSLYVPPTLEEKPLELTVLD
MQSRSVLEPVIGRFGFDVEVKPHTFPILGRVAELLAKQGHPSSPWLGLDSFAWGGEKLRVGSLYVPPTLEEKPLELTVLD

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KGSYELRGPDGEIMLRGIVGTQAKSAEGVSITINEIVARPGTQFKVVHHNTFDAIETMRRQIRVAEVTKDTGIVQISFTS
KGSYELRGPDGEIMLRGIVGTQAKSAEGVSITINEIVARPGTQFKVVHHNTFDAIETMRRQIRVAEVTKDTGIVQISFTS

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SHPILTADVANALAEQYIATAVKRQQLNDTNTLEFIRQELPRLGADLRRSEEALSSYQSSSQSLHPTAEAQAYLQGSIEL
SHPILTADVANALAEQ                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QQRLASLQLQRTQLMQLFTANSPQVQNIDKQLAQLQKASSAFDTRFGRMPTSERRSAELTRDAKVAEAIYLSMVNKAEEL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SVRRASTSGGAQIVDKALRQYKPIKPNRLLIIGAGGGLGFLGGMLLIFLRRHVMTGVTDPFFVERRLSVPVIGEVLFSQK


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QAQLDQEIATTTMRHVSPRSSAGSTSLIKSGELRDSHRNPQLEGPSVTPEIVRERARLLALRFPNEPAVEALRAVRTEVC


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EELAQRRINIAMLTGPSPSAGKSFVAANLAVLLAEIRLRVLLIDADMRRGNLASFFRQSNPGGLADVLGGTMHVSDAIRS
             TGPSPSAGKSFVAANLAVLLAEIRLRVLLIDADMRRGNLASFFRQSNPGGLADVLGGTMHVSDAIRS
                    GKS                 LLIDADMR                                
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VGVPGLSFMSCGSYPSNPSELLMMPECKKTLNELSEQFDVVLVDTPPILVLTDAAIIARQAGATILVLRSGMQSEDEISD
VGVPGLSFMSCGSYPSNPSELLMMPECKKTLNELSEQFDVVLVDTPPILVLTDAAIIARQAGATILVLRSGMQSEDEISD
                                        VLVDTPP                                 
       730       740       750       760 
....:....|....:....|....:....|....:....|.
TVRKLQRAGGNLLGSVFNAIPMRSSNWRSYGYPSEYMRTIQ
TVRKLQRAGGNLLGSVFNAIPMRSSNWRSYGYPSEYMRTIQ
                             YGYPSEY     

© 1998-2019