BYKdb

Annotate results for A0A158GG75

A0A158GG75 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A158GG75
DOMAINtad1/245MLIAAIAGSVMILGGLYAFLSEPVYQANILIKVDDTSGAPTSSGRDILSNVSASFDAKSS
AEGEMQILGSKLIVSHAVDALKLYINAKPHYFPLIGAWVARYYKSLPWPHFLQADGYAWA
NEAIDIASLDVPKDMEGAGLSITALEDGRYSLDGDQLDAPVTGKVGVTERFDTKQGVITL
RVDRLVGKPGAAFDVVRSSRQDVVADLQKALQITEQGTKSNVLSLTLRGRDPARVSATVN
EIGRE
DOMAINcd522/715AGPLPEIGKSFVTANLATILAAGGKRVLLVDGDLRKGHLHTSLGCALAPGLAEALVHPDS
FDKLIQKQIQPNLDFLQAGFYPSNPSELLMGKNFSTLMIAASNQYDIVLIDSAPALAVSD
AGIMAPIAGSIFLVARFGQTRIGEIEESTKRFAQTGARVSGVLLNGFSLRRANYGHASRY
GSHAYTAYKYDASV
SITEWalker A529/531GKS
SITEWalker A'549/556LLVDGDLR
SITEWalker B629/635VLIDSAP
SITEY Cluster695/711YGHASRYGSHAYTAYKY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLIAAIAGSVMILGGLYAFLSEPVYQANILIKVDDTSGAPTSSGRDILSNVSASFDAKSSAEGEMQILGSKLIVSHAVDA
MLIAAIAGSVMILGGLYAFLSEPVYQANILIKVDDTSGAPTSSGRDILSNVSASFDAKSSAEGEMQILGSKLIVSHAVDA

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LKLYINAKPHYFPLIGAWVARYYKSLPWPHFLQADGYAWANEAIDIASLDVPKDMEGAGLSITALEDGRYSLDGDQLDAP
LKLYINAKPHYFPLIGAWVARYYKSLPWPHFLQADGYAWANEAIDIASLDVPKDMEGAGLSITALEDGRYSLDGDQLDAP

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VTGKVGVTERFDTKQGVITLRVDRLVGKPGAAFDVVRSSRQDVVADLQKALQITEQGTKSNVLSLTLRGRDPARVSATVN
VTGKVGVTERFDTKQGVITLRVDRLVGKPGAAFDVVRSSRQDVVADLQKALQITEQGTKSNVLSLTLRGRDPARVSATVN

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EIGREYVRQNADRKAVIAANSLDFLQSQMPAMKQQMEEAEARYNAYRNTHTLLDIGEESRIALKNASEAEIQLLTLRRTR
EIGRE                                                                           

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SELSSKFRAMHPSIVAVDEQIASMQNYLDDLNERVKSLPVDEQGALRLMREVRVSSDLYSELRKNIEELRLIRAGKVGAA


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QLIDASDTPKHPIRPIKSLILLVSALLGVLIGVGVTLMLDHLFAGVTEPEDIEAQTGLMVYATLPLSPKQRELEKQAETE


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PERQGLLALRFPGDPTVESLRSFRSALQFAILGARNNIVMLAGPLPEIGKSFVTANLATILAAGGKRVLLVDGDLRKGHL
                                         AGPLPEIGKSFVTANLATILAAGGKRVLLVDGDLRKGHL
                                                GKS                 LLVDGDLR    
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HTSLGCALAPGLAEALVHPDSFDKLIQKQIQPNLDFLQAGFYPSNPSELLMGKNFSTLMIAASNQYDIVLIDSAPALAVS
HTSLGCALAPGLAEALVHPDSFDKLIQKQIQPNLDFLQAGFYPSNPSELLMGKNFSTLMIAASNQYDIVLIDSAPALAVS
                                                                    VLIDSAP     
       650       660       670       680       690       700       710      
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:.
DAGIMAPIAGSIFLVARFGQTRIGEIEESTKRFAQTGARVSGVLLNGFSLRRANYGHASRYGSHAYTAYKYDASVQ
DAGIMAPIAGSIFLVARFGQTRIGEIEESTKRFAQTGARVSGVLLNGFSLRRANYGHASRYGSHAYTAYKYDASV 
                                                      YGHASRYGSHAYTAYKY     

© 1998-2019