BYKdb

Annotate results for A0A158GPJ1

A0A158GPJ1 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A158GPJ1
DOMAINtad18/272GQLSAKDMINLMRDHIWEILVATVVVVALAVAYIFIAPPIYSADVLIRVDPPEQNQLGIA
LQNQETLPPPAPAPSEEMAVMRSRSVLEPVIEKYRFDVSVTPHMFPLLGDIAEKFATPGE
PSKPWLGLKSFAWGGERVQVGSLDVPQNLEEEKLKLIALDGGRYELRGPSNELLVSGMVG
VPASANGVSIVLKQLDARPGTSFEVIRWNDLDAVKRFANTVKVSDKVKDSGLIEIEYTDK
SPAKATEVTNALAEQ
DOMAINcd580/767TGPTPSAGKSFVAANLAVLHAETGARVLLIDADMRRGHLASFFKQRNRGGLSEVLSNRMP
VRNALRHVGVEGVSFISCGTRPANPAALLMQQGFRDLLDRLGKQFDLVIVDTPPFLAVTD
ASIIASEAGSSLLVLRSGMQSEEEIADTVRKLARAEGRIAGAVFNGIPLRRSNRGYGYAT
NYASDHGD
SITEWalker A587/589GKS
SITEWalker A'607/614LLIDADMR
SITEWalker B687/693VIVDTPP
SITEY Cluster755/761YGYATNY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDYYPSNSLSPSADHERGQLSAKDMINLMRDHIWEILVATVVVVALAVAYIFIAPPIYSADVLIRVDPPEQNQLGIALQN
                 GQLSAKDMINLMRDHIWEILVATVVVVALAVAYIFIAPPIYSADVLIRVDPPEQNQLGIALQN

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QETLPPPAPAPSEEMAVMRSRSVLEPVIEKYRFDVSVTPHMFPLLGDIAEKFATPGEPSKPWLGLKSFAWGGERVQVGSL
QETLPPPAPAPSEEMAVMRSRSVLEPVIEKYRFDVSVTPHMFPLLGDIAEKFATPGEPSKPWLGLKSFAWGGERVQVGSL

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DVPQNLEEEKLKLIALDGGRYELRGPSNELLVSGMVGVPASANGVSIVLKQLDARPGTSFEVIRWNDLDAVKRFANTVKV
DVPQNLEEEKLKLIALDGGRYELRGPSNELLVSGMVGVPASANGVSIVLKQLDARPGTSFEVIRWNDLDAVKRFANTVKV

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SDKVKDSGLIEIEYTDKSPAKATEVTNALAEQYLATAIASRQSNDTKTLAFINGELPRLLADLRKAEEALKSYRSTSNSM
SDKVKDSGLIEIEYTDKSPAKATEVTNALAEQ                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QPTAEAQSFLQGGIDFDRQIASLQLQRTQLLERFTPTSRWVQNIDTQLAQLNKAKGEFDGRFRSMPTSERESVDLIRAQK


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VAETIYLGMVQKAEQLTVRRASTSGGAHVVDSAVRPHRPVKPNRPVVLGGGVVLGLLTGVFLVFMRRHVMIGVTDPRYVE


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RRLSVPVLGEVLFSQQQMRLDPSSAGVPKKALPPVLKPGLPFPRAEPVGDFSDAGTLDGVGSRVLAARFPHDPSVEALRA


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VRTALTRDLAHAPNNIVMVTGPTPSAGKSFVAANLAVLHAETGARVLLIDADMRRGHLASFFKQRNRGGLSEVLSNRMPV
                   TGPTPSAGKSFVAANLAVLHAETGARVLLIDADMRRGHLASFFKQRNRGGLSEVLSNRMPV
                          GKS                 LLIDADMR                          
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RNALRHVGVEGVSFISCGTRPANPAALLMQQGFRDLLDRLGKQFDLVIVDTPPFLAVTDASIIASEAGSSLLVLRSGMQS
RNALRHVGVEGVSFISCGTRPANPAALLMQQGFRDLLDRLGKQFDLVIVDTPPFLAVTDASIIASEAGSSLLVLRSGMQS
                                              VIVDTPP                           
       730       740       750       760       770  
....:....|....:....|....:....|....:....|....:....|..
EEEIADTVRKLARAEGRIAGAVFNGIPLRRSNRGYGYATNYASDHGDVETVH
EEEIADTVRKLARAEGRIAGAVFNGIPLRRSNRGYGYATNYASDHGD     
                                  YGYATNY           

© 1998-2019