BYKdb

Annotate results for A0A158IFY6

A0A158IFY6 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A158IFY6
DOMAINtad18/276GEFTASDMLRLLRDHLGMLFLFIGIAAALATAYAFLAKPIYSSDVVVRVDPPDPNALGIA
PQNQMQMQQSLPTVNQLAPAEISVMQSRSVLEPVVKQFHFDIKSKPKTFPVLGQIAELFA
KKGHLAPAWFGLDSYGWGGEELQIGRLDVPPALEDQKLDLVLLENHQYELRDPDGETILR
GTIGRPATANGVSILVNSAIGHPGVRFDVTRLNTLDAIALMKKTMKVAESAKDTGVVQIT
FNADDPALTADVANALGQA
DOMAINcd593/781TGPIPSAGKSFVAANLSVLLAEIGLRVLLIDGDMRRGHIASFFKQSNPGGLSEVLKGEMA
LGDAIRYVGVPGLSFISCGAYPENPSELLMMPGFRNMLARMSDQFDLVLLDTPPFLVVTD
AAIVASDAGSTVLVLRSGIQSEEEIEETVKKVQRAGGRLVGSVFNAIPRRPSNRRSYGYA
AAYTSTFKS
SITEWalker A600/602GKS
SITEWalker A'620/627LLIDGDMR
SITEWalker B700/706VLLDTPP
SITEY Cluster769/775YGYAAAY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNTLYVNNGSSRPGKDDGEFTASDMLRLLRDHLGMLFLFIGIAAALATAYAFLAKPIYSSDVVVRVDPPDPNALGIAPQN
                 GEFTASDMLRLLRDHLGMLFLFIGIAAALATAYAFLAKPIYSSDVVVRVDPPDPNALGIAPQN

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QMQMQQSLPTVNQLAPAEISVMQSRSVLEPVVKQFHFDIKSKPKTFPVLGQIAELFAKKGHLAPAWFGLDSYGWGGEELQ
QMQMQQSLPTVNQLAPAEISVMQSRSVLEPVVKQFHFDIKSKPKTFPVLGQIAELFAKKGHLAPAWFGLDSYGWGGEELQ

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IGRLDVPPALEDQKLDLVLLENHQYELRDPDGETILRGTIGRPATANGVSILVNSAIGHPGVRFDVTRLNTLDAIALMKK
IGRLDVPPALEDQKLDLVLLENHQYELRDPDGETILRGTIGRPATANGVSILVNSAIGHPGVRFDVTRLNTLDAIALMKK

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TMKVAESAKDTGVVQITFNADDPALTADVANALGQAYLSAAVQARQANDTKTLEFIRGELPRLEHDLKVAEGNLSTFRAK
TMKVAESAKDTGVVQITFNADDPALTADVANALGQA                                            

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SQSVQPIPEAQAYLQGSIVSMQQLATLKLQRTQALQRFQPSSPQVVNLDQQIAELEASNKQIQQRFDSMPQSERQNATLT


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RDARVAETIYMGMVNKAQELSVRRASTSGGAHIVDNALRPYRPVKPNKSLVIVAGTGLGFFIGTFFIFLRRHAMIGVTDP


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFVERRLSVPVLGEVLYSRQQAMLDHEIAVSPVEHAPLTYSGTQDGGPPRALPHIELPEHDAFAMPHVADTDRNARVLAT


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RYPHDPAIEALRAVRTELYRDLANAPNNIVMLTGPIPSAGKSFVAANLSVLLAEIGLRVLLIDGDMRRGHIASFFKQSNP
                                TGPIPSAGKSFVAANLSVLLAEIGLRVLLIDGDMRRGHIASFFKQSNP
                                       GKS                 LLIDGDMR             
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GGLSEVLKGEMALGDAIRYVGVPGLSFISCGAYPENPSELLMMPGFRNMLARMSDQFDLVLLDTPPFLVVTDAAIVASDA
GGLSEVLKGEMALGDAIRYVGVPGLSFISCGAYPENPSELLMMPGFRNMLARMSDQFDLVLLDTPPFLVVTDAAIVASDA
                                                           VLLDTPP              
       730       740       750       760       770       780   
....:....|....:....|....:....|....:....|....:....|....:....|...
GSTVLVLRSGIQSEEEIEETVKKVQRAGGRLVGSVFNAIPRRPSNRRSYGYAAAYTSTFKSMS
GSTVLVLRSGIQSEEEIEETVKKVQRAGGRLVGSVFNAIPRRPSNRRSYGYAAAYTSTFKS  
                                                YGYAAAY        

© 1998-2019