BYKdb

Annotate results for A0A158KB00

A0A158KB00 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A158KB00
DOMAINtad16/284RGDGVVDLWRSVVRHKTLLGAVTGTCCAAGVLYILLATPQYRAEALLRVQSKAGVAISAL
SDVSGSMAADGSASDESDVLTSRSVVSAAIAQTGAETVVETQSFFPVIGRWFATRHATDR
ELAPALFGLDQYAWGGERLTPGVFDVPKAALQMKFHVVAGEGGRWTLFDKNDTRLAEGRV
GETVPFQVTTPDGQAPGELRIDTLRARPGVSFQITKYSQQMTFDNVLQRLRTSIPPRESS
LRDPALIHLTYQAESPFEAQAMVNAIIKT
DOMAINcd612/798TGPTQGVGKSFVSSNFAYLLAETRASVLLIDADMRQGRLRHLVDGREGPGLAEVLAGTAR
VEDAIVPLGNGGLSMMDAGAEYPENPAELLTRPAFQEMMTMLREIYDYIVIDSPPVLPVS
DALSIAMQNCDLVLLVSRADRTGARQLEETLRRLENVGAKVGGHVFNGFAPGRYGAREEY
GIRTSTR
SITEWalker A619/621GKS
SITEWalker A'639/646LLIDADMR
SITEWalker B720/726IVIDSPP
SITE-717/-719YDY
SITEY Cluster785/791YGAREEY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLSYNMRPTLTPVPQRGDGVVDLWRSVVRHKTLLGAVTGTCCAAGVLYILLATPQYRAEALLRVQSKAGVAISALSDVSG
               RGDGVVDLWRSVVRHKTLLGAVTGTCCAAGVLYILLATPQYRAEALLRVQSKAGVAISALSDVSG

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SMAADGSASDESDVLTSRSVVSAAIAQTGAETVVETQSFFPVIGRWFATRHATDRELAPALFGLDQYAWGGERLTPGVFD
SMAADGSASDESDVLTSRSVVSAAIAQTGAETVVETQSFFPVIGRWFATRHATDRELAPALFGLDQYAWGGERLTPGVFD

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VPKAALQMKFHVVAGEGGRWTLFDKNDTRLAEGRVGETVPFQVTTPDGQAPGELRIDTLRARPGVSFQITKYSQQMTFDN
VPKAALQMKFHVVAGEGGRWTLFDKNDTRLAEGRVGETVPFQVTTPDGQAPGELRIDTLRARPGVSFQITKYSQQMTFDN

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLQRLRTSIPPRESSLRDPALIHLTYQAESPFEAQAMVNAIIKTYQQRDIERRAAQAQTSLDFLRQRLPALRADLERAEG
VLQRLRTSIPPRESSLRDPALIHLTYQAESPFEAQAMVNAIIKT                                    

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RLNSFRTQTGTVDMQQQNVALIARMSSLEERQTTLQLALDAAQHRYRPDSEQYQAALTQLNQVKREIGDASKTAANLPSI


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QRQYVELARDVAVTTQLYTSVLTNTQQLEVAAASTPPGIAVVDWAVAPEKQSWPRQWIVLLGSIFGGLFVSTVSIYLIAL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HRRELRSPEEIDHFSQVPRLAVIARSTAQLRQDVRALTHNAAPAKLLAMTSPTDPSVEALRSLRSSVRAMLSGVPLANHP


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GFHGLHPMNPLNPMNPMALSHAVGNTMSVMNPGYVVEATDTNDGGGRVILFTGPTQGVGKSFVSSNFAYLLAETRASVLL
                                                   TGPTQGVGKSFVSSNFAYLLAETRASVLL
                                                          GKS                 LL
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IDADMRQGRLRHLVDGREGPGLAEVLAGTARVEDAIVPLGNGGLSMMDAGAEYPENPAELLTRPAFQEMMTMLREIYDYI
IDADMRQGRLRHLVDGREGPGLAEVLAGTARVEDAIVPLGNGGLSMMDAGAEYPENPAELLTRPAFQEMMTMLREIYDYI
IDADMR                                                                         I
       730       740       750       760       770       780       790        
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:...
VIDSPPVLPVSDALSIAMQNCDLVLLVSRADRTGARQLEETLRRLENVGAKVGGHVFNGFAPGRYGAREEYGIRTSTR
VIDSPPVLPVSDALSIAMQNCDLVLLVSRADRTGARQLEETLRRLENVGAKVGGHVFNGFAPGRYGAREEYGIRTSTR
VIDSPP                                                          YGAREEY       

© 1998-2019