BYKdb

Annotate results for A0A158KK93

A0A158KK93 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A158KK93
DOMAINtad18/272GQLSARGVLSLMRDHAWEIARIAGLVFALAVVYLYVASPLYSADVLVRVDAPEPNALGIA
LQNQDNAPPSAPSATAEMQVMQSRSVIQPVLERFRFDISATPVMVPLLGKIASKFANPGE
LSEPWLGLKTFAWGGEEIKIAALEVPRELEGERMQLVALGSNSYELQGPSGEHLLSGTVG
KTESSYGVSMKVEQLVARPGTRFKVIRWNTLDAIAQFLAAVKVKAKEQDTGIVSITYNNE
DPALAAEIANALAQQ
DOMAINcd591/778TGPTPSAGKSFVAANIAVLQAETGSRVLLIDADMRRGRLAYFFGQYNRGGLSDVLAGDTD
PSELIRNVGIHGLSFMSCGSYPDNPAELLMKRRFKDMLQRMGQEYDLVIVDTPPFLAVTD
AAIVAGEAGATILVLRSGMQSEYEITETVKKLERSEANLVGAIFNAIPLRRSNRNYGYAT
GYATLDLI
SITEWalker A598/600GKS
SITEWalker A'618/625LLIDADMR
SITEWalker B698/704VIVDTPP
SITE-631/-636YFFGQY
SITEY Cluster766/772YGYATGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNLFRFSNAPSATATDQGQLSARGVLSLMRDHAWEIARIAGLVFALAVVYLYVASPLYSADVLVRVDAPEPNALGIALQN
                 GQLSARGVLSLMRDHAWEIARIAGLVFALAVVYLYVASPLYSADVLVRVDAPEPNALGIALQN

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QDNAPPSAPSATAEMQVMQSRSVIQPVLERFRFDISATPVMVPLLGKIASKFANPGELSEPWLGLKTFAWGGEEIKIAAL
QDNAPPSAPSATAEMQVMQSRSVIQPVLERFRFDISATPVMVPLLGKIASKFANPGELSEPWLGLKTFAWGGEEIKIAAL

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EVPRELEGERMQLVALGSNSYELQGPSGEHLLSGTVGKTESSYGVSMKVEQLVARPGTRFKVIRWNTLDAIAQFLAAVKV
EVPRELEGERMQLVALGSNSYELQGPSGEHLLSGTVGKTESSYGVSMKVEQLVARPGTRFKVIRWNTLDAIAQFLAAVKV

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KAKEQDTGIVSITYNNEDPALAAEIANALAQQYIASAVSARQRDDTNTLAFINSELPRLRADLKQSEEALNKFRMSSQSL
KAKEQDTGIVSITYNNEDPALAAEIANALAQQ                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QPTAESQAYLQGGIDFQRQISTLQLQRTQLLRTYQPDSQWVRNVDSQIAQLASAKSTFDARFGNMPTSERMSVELARDAR


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VSESIYLGMVNKAEQLSVRRASTTGGVNVVDYALRPHRPIKPNSLLVLSGGAGIGLVAGVFFVFIRRHVMMGVTDPHFVE


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RVTSVPVFGEVLFSPQQARLDQEISAATRRPTTARNGRTSGAAPVRPLPSIAAAGGGSSPNAASVPRLGFSATRVLAARF


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PQDVTVEALRVVRTMLNRGLTHVSNNIVMFTGPTPSAGKSFVAANIAVLQAETGSRVLLIDADMRRGRLAYFFGQYNRGG
                              TGPTPSAGKSFVAANIAVLQAETGSRVLLIDADMRRGRLAYFFGQYNRGG
                                     GKS                 LLIDADMR               
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LSDVLAGDTDPSELIRNVGIHGLSFMSCGSYPDNPAELLMKRRFKDMLQRMGQEYDLVIVDTPPFLAVTDAAIVAGEAGA
LSDVLAGDTDPSELIRNVGIHGLSFMSCGSYPDNPAELLMKRRFKDMLQRMGQEYDLVIVDTPPFLAVTDAAIVAGEAGA
                                                         VIVDTPP                
       730       740       750       760       770       780  
....:....|....:....|....:....|....:....|....:....|....:....|..
TILVLRSGMQSEYEITETVKKLERSEANLVGAIFNAIPLRRSNRNYGYATGYATLDLIEGSD
TILVLRSGMQSEYEITETVKKLERSEANLVGAIFNAIPLRRSNRNYGYATGYATLDLI    
                                             YGYATGY          

© 1998-2019