BYKdb

Annotate results for A0A158LLW9

A0A158LLW9 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A158LLW9
DOMAINcd41/229TSVKAGEGKTTTSTNIAWAFARAGYKTLLIDADMRNSVMSGVFKSRERITGLTEFLSGTT
DLSQGLCDTNIENLFVIQAGSVSPNPTALLQSKNFSTMLETLRKYFDYIVVDTPPVGVVI
DAAIIMQKCDASILVTKAGETKRRDLQKAKEQLEQTGKSCLGVVLNKLDTSVEKYGSYGS
YGNYRKQKK
SITE-197/-199GKS
SITEWalker A'68/75LLIDADMR
SITEWalker B149/155IVVDTPP
SITE-145/-148YFDY
SITEY Cluster215/224YGSYGSYGNY
SITEWalker A48/50GKT
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPTLEISQAKLELVKKAEEYYNALCTNLQLSGDDLKVFSITSVKAGEGKTTTSTNIAWAFARAGYKTLLIDADMRNSVMS
                                        TSVKAGEGKTTTSTNIAWAFARAGYKTLLIDADMRNSVMS
                                               GKT                 LLIDADMR     
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GVFKSRERITGLTEFLSGTTDLSQGLCDTNIENLFVIQAGSVSPNPTALLQSKNFSTMLETLRKYFDYIVVDTPPVGVVI
GVFKSRERITGLTEFLSGTTDLSQGLCDTNIENLFVIQAGSVSPNPTALLQSKNFSTMLETLRKYFDYIVVDTPPVGVVI
                                                                    IVVDTPP     
       170       180       190       200       210       220         
....:....|....:....|....:....|....:....|....:....|....:....|....:....
DAAIIMQKCDASILVTKAGETKRRDLQKAKEQLEQTGKSCLGVVLNKLDTSVEKYGSYGSYGNYRKQKK
DAAIIMQKCDASILVTKAGETKRRDLQKAKEQLEQTGKSCLGVVLNKLDTSVEKYGSYGSYGNYRKQKK
                                                      YGSYGSYGNY     
© 1998-2019