BYKdb

Annotate results for A0A158SMM3

A0A158SMM3 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A158SMM3
DOMAINcd57/249TSSGKSEGKSTVTANVAIAWAQEGKRVLLIDADLRRSTLHATFGLNNQKGLTTVLTGDSK
EVDLSNVVQKSGVENLEVLTAGPVPPNPSELLGSQRMQSLIKGLREAYDIVVLDVPPMLQ
VTDTQVLSSNLDGVILVVRQGVTQKAAIRRAVEMLKISQANVLGYVMNDVYDDDAGYGYG
YGYGYGYGYEGDE
SITEWalker A60/62GKS
SITEWalker A'84/91LLIDADLR
SITEWalker B167/173VVLDVPP
SITEY Cluster221/245YVMNDVYDDDAGYGYGYGYGYGYGY
SITEWalker A64/66GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MGLFKHRYTKSTDTMNNGVMLITLADPKSGPAEQFRTIRTNIHYMSVDRPLKTVAFTSSGKSEGKSTVTANVAIAWAQEG
                                                        TSSGKSEGKSTVTANVAIAWAQEG
                                                           GKS GKS              
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KRVLLIDADLRRSTLHATFGLNNQKGLTTVLTGDSKEVDLSNVVQKSGVENLEVLTAGPVPPNPSELLGSQRMQSLIKGL
KRVLLIDADLRRSTLHATFGLNNQKGLTTVLTGDSKEVDLSNVVQKSGVENLEVLTAGPVPPNPSELLGSQRMQSLIKGL
   LLIDADLR                                                                     
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
REAYDIVVLDVPPMLQVTDTQVLSSNLDGVILVVRQGVTQKAAIRRAVEMLKISQANVLGYVMNDVYDDDAGYGYGYGYG
REAYDIVVLDVPPMLQVTDTQVLSSNLDGVILVVRQGVTQKAAIRRAVEMLKISQANVLGYVMNDVYDDDAGYGYGYGYG
      VVLDVPP                                               YVMNDVYDDDAGYGYGYGYG
       250
....:....|
YGYGYEGDEE
YGYGYEGDE 
YGYGY     
© 1998-2019