BYKdb

Annotate results for A0A160FHD2

A0A160FHD2 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A160FHD2
DOMAINtad19/282DELHLSDYLRTIVRGWRTVLTVTLIALALGCAYAFLASPTYRADVLFHVEDKAANANANG
KDSLPQLTSMFDTRPSTAAEIELLKSRLVTEDTVKKLHLDITATPRYFPVIGRMIAGLVN
GQWGFRLPSFINLSGFAWGDQSIAMSRFDTSKEMYDTTFTLIAGGGGTYVLRDRNGIAIL
SGRVGETVETDTADGPIALHVDKLVGAPGSRFELSRASTLSTVNHLQNALVVEETTQQSG
VIRASLEGGDSALTAAIVNNVASE
DOMAINcd559/747TGSRPDAGKSFLSVNLSALVASANKRVLIIDGDMRRGDVHSHFGITHQPGLSDVLSGGDL
NSMIQRDVLPGLDVLAKGTLPAHPAELLMSKRFEMMLDELKPQYDLVIVDTPPVLAVTDS
TLIGRYAGTTLLVVRHGRHPLNEIIETAKRLRNGGVAMRGVLLTDVPQEGAFLGSGYQGG
YYGYDSIAG
SITEWalker A566/568GKS
SITEWalker A'586/593LIIDGDMR
SITEWalker B665/671VIVDTPP
SITEY Cluster735/742YQGGYYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAINFEHRYTGYTDVSGPDELHLSDYLRTIVRGWRTVLTVTLIALALGCAYAFLASPTYRADVLFHVEDKAANANANGKD
                  DELHLSDYLRTIVRGWRTVLTVTLIALALGCAYAFLASPTYRADVLFHVEDKAANANANGKD

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SLPQLTSMFDTRPSTAAEIELLKSRLVTEDTVKKLHLDITATPRYFPVIGRMIAGLVNGQWGFRLPSFINLSGFAWGDQS
SLPQLTSMFDTRPSTAAEIELLKSRLVTEDTVKKLHLDITATPRYFPVIGRMIAGLVNGQWGFRLPSFINLSGFAWGDQS

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IAMSRFDTSKEMYDTTFTLIAGGGGTYVLRDRNGIAILSGRVGETVETDTADGPIALHVDKLVGAPGSRFELSRASTLST
IAMSRFDTSKEMYDTTFTLIAGGGGTYVLRDRNGIAILSGRVGETVETDTADGPIALHVDKLVGAPGSRFELSRASTLST

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VNHLQNALVVEETTQQSGVIRASLEGGDSALTAAIVNNVASEFMRQDMESRSTAGEHMLAFLDQELPGARKELDEAEQRY
VNHLQNALVVEETTQQSGVIRASLEGGDSALTAAIVNNVASE                                      

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NKFRNEHGAVDLGEESRLLLQQVVDNKTRLLDLQQQRAEMSQRFTANHPAVAALDAQIAALQGAQINMNRSVAAMPDNEQ


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TALRLLRDVHVTTEQYTNLLNSAQQLRVAKAGQVGTMRVVDFAEAPDEPVRPKRMLVILIALGGGLALGILLTFLKRAMF


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GGVERPDELEGMLGLPVFAVVPRSQTQLRLQQQVSLRRRGLHVLAQQAPADIAVEGVRNLHTSLQLSLDHAENNVVMITG
                                                                              TG

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SRPDAGKSFLSVNLSALVASANKRVLIIDGDMRRGDVHSHFGITHQPGLSDVLSGGDLNSMIQRDVLPGLDVLAKGTLPA
SRPDAGKSFLSVNLSALVASANKRVLIIDGDMRRGDVHSHFGITHQPGLSDVLSGGDLNSMIQRDVLPGLDVLAKGTLPA
     GKS                 LIIDGDMR                                               
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HPAELLMSKRFEMMLDELKPQYDLVIVDTPPVLAVTDSTLIGRYAGTTLLVVRHGRHPLNEIIETAKRLRNGGVAMRGVL
HPAELLMSKRFEMMLDELKPQYDLVIVDTPPVLAVTDSTLIGRYAGTTLLVVRHGRHPLNEIIETAKRLRNGGVAMRGVL
                        VIVDTPP                                                 
       730       740       
....:....|....:....|....:..
LTDVPQEGAFLGSGYQGGYYGYDSIAG
LTDVPQEGAFLGSGYQGGYYGYDSIAG
              YQGGYYGY     

© 1998-2019