BYKdb

Annotate results for A0A160FKL1

A0A160FKL1 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A160FKL1
DOMAINtad10/267EDVVLGQLVQVILDDIWWLIAIAGVIVALAAAYCFLAKPIYSADAHVRVEQSDNTSQALT
QTQTGAAITTGSTSLPTDAEIEIIKSRGVVGPVVQQLKLNFSVVPKTIPLLGSIAAHMAT
PGQLAQPWLGLASYAWGGEDAEIDSLDVVPALEGEKLTMKVFDEQHYELYAKNGTLLLRG
QVGQQEQGGGVTILVSKLVARPGEEFTVTRFNDLDAITAFQSAITVQEQGKQTGVIQISL
EDKSPEHAALVANALAQS
DOMAINcd545/732TGPMSGVGKSFLTVNLAVLLANSGKRVLMIDGDMRRGVLERYMGGAQDNGMSELLSGQIS
LEEAIRTSNVEGLSFISCGRRPPNPSELLMSPRLPQYLDGLAKRYDVILIDTPPVLAVTD
ASIIGAYAGSTFFVIRSGVHNEGEIAEALKRLRAAGVHVQGGIFNGMPARSRGGYTHGYA
AVEEYLST
SITEWalker A552/554GKS
SITEWalker A'572/579LMIDGDMR
SITEWalker B652/658ILIDTPP
SITEY Cluster719/729YTHGYAAVEEY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAGPIKTEEEDVVLGQLVQVILDDIWWLIAIAGVIVALAAAYCFLAKPIYSADAHVRVEQSDNTSQALTQTQTGAAITTG
         EDVVLGQLVQVILDDIWWLIAIAGVIVALAAAYCFLAKPIYSADAHVRVEQSDNTSQALTQTQTGAAITTG

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
STSLPTDAEIEIIKSRGVVGPVVQQLKLNFSVVPKTIPLLGSIAAHMATPGQLAQPWLGLASYAWGGEDAEIDSLDVVPA
STSLPTDAEIEIIKSRGVVGPVVQQLKLNFSVVPKTIPLLGSIAAHMATPGQLAQPWLGLASYAWGGEDAEIDSLDVVPA

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LEGEKLTMKVFDEQHYELYAKNGTLLLRGQVGQQEQGGGVTILVSKLVARPGEEFTVTRFNDLDAITAFQSAITVQEQGK
LEGEKLTMKVFDEQHYELYAKNGTLLLRGQVGQQEQGGGVTILVSKLVARPGEEFTVTRFNDLDAITAFQSAITVQEQGK

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QTGVIQISLEDKSPEHAALVANALAQSYVRQHVSNKQVDASKMLDFLKSEEPRLKSDLERAEAALTAYQRQSGSINASDE
QTGVIQISLEDKSPEHAALVANALAQS                                                     

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AKVYLEGSVQYEQQIAGLRLQMAQLTERYGDDHPMLVAARQQMAELEAQRAKYADRFRDLPATEVKAVQLQRDAKVAEDI


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YVLLLNRVQELSVQKAGTGGNVHIVDQAMRPGAPVKPKKVLILSAAVILGLICGTGFVFLRRNMFKGIDDPDHIERAFHL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PVYGLVPLSAEQAVLESGFQRGGERLRSVLANARPKDVTIESLRSLRTSMQFTMMDAKNRIVMLTGPMSGVGKSFLTVNL
                                                                TGPMSGVGKSFLTVNL
                                                                       GKS      
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AVLLANSGKRVLMIDGDMRRGVLERYMGGAQDNGMSELLSGQISLEEAIRTSNVEGLSFISCGRRPPNPSELLMSPRLPQ
AVLLANSGKRVLMIDGDMRRGVLERYMGGAQDNGMSELLSGQISLEEAIRTSNVEGLSFISCGRRPPNPSELLMSPRLPQ
           LMIDGDMR                                                             
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YLDGLAKRYDVILIDTPPVLAVTDASIIGAYAGSTFFVIRSGVHNEGEIAEALKRLRAAGVHVQGGIFNGMPARSRGGYT
YLDGLAKRYDVILIDTPPVLAVTDASIIGAYAGSTFFVIRSGVHNEGEIAEALKRLRAAGVHVQGGIFNGMPARSRGGYT
           ILIDTPP                                                            YT
       730  
....:....|..
HGYAAVEEYLST
HGYAAVEEYLST
HGYAAVEEY   

© 1998-2019