BYKdb

Annotate results for A0A160FUR2

A0A160FUR2 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A160FUR2
DOMAINtad16/274DEIDLIGVLDVFVEYRWVILKICLCCLVLATAFAFLFPPRYQADISVQVGDGSGSAAAQS
LLGNVSSLFDYNSPTSAEQQIMASRLVVTSVVDELRSYIVVHPRRFPLIGNFISGFNDAV
MRPGVLGIGGWAWGTESADIVQFDVPKRLEGDQFALTVLSGDRYRLSGWDLDEAVTGRVG
AAEVFQTGSGPMTLLVKSFNAAPGTKFKLTRKSRLDTIMSMQKGLEIQEKIKSSGVLIAT
LTAADPVLVRDQLQAIGRY
DOMAINcd551/744SGPSPGVGKSFVSANFAALLATSGKRVLVIDGDLRRGYLHEYFGRQRARGLTDVITGALS
LDEVIHRSVVPNLDFIATGVLPPSSAEILMHERVGQLLEDSAHDYDVVLVDSPPVLAAVD
AVVLAEHCATVMLVARAGHTRVGELTESVRQFAHAGVAVSGALLNGLDPKSGRRSYNRKN
GGYRYVQYCYEDPR
SITEWalker A558/560GKS
SITEWalker A'578/585LVIDGDLR
SITEWalker B658/664VLVDSPP
SITE-588/-592YLHEY
SITEY Cluster733/740YRYVQYCY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKPLQSPESEALKQDDEIDLIGVLDVFVEYRWVILKICLCCLVLATAFAFLFPPRYQADISVQVGDGSGSAAAQSLLGNV
               DEIDLIGVLDVFVEYRWVILKICLCCLVLATAFAFLFPPRYQADISVQVGDGSGSAAAQSLLGNV

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SSLFDYNSPTSAEQQIMASRLVVTSVVDELRSYIVVHPRRFPLIGNFISGFNDAVMRPGVLGIGGWAWGTESADIVQFDV
SSLFDYNSPTSAEQQIMASRLVVTSVVDELRSYIVVHPRRFPLIGNFISGFNDAVMRPGVLGIGGWAWGTESADIVQFDV

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PKRLEGDQFALTVLSGDRYRLSGWDLDEAVTGRVGAAEVFQTGSGPMTLLVKSFNAAPGTKFKLTRKSRLDTIMSMQKGL
PKRLEGDQFALTVLSGDRYRLSGWDLDEAVTGRVGAAEVFQTGSGPMTLLVKSFNAAPGTKFKLTRKSRLDTIMSMQKGL

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EIQEKIKSSGVLIATLTAADPVLVRDQLQAIGRYYVKQNVERKAAEAAQSLAFLDTQVPLLRKQLVDAEARYTQMRKKQG
EIQEKIKSSGVLIATLTAADPVLVRDQLQAIGRY                                              

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TVDLQEEARIAIQQTADSRTRMLELQQKRDELASRFTSSHPEVIALNAQIATLRSQQSAFDRQMRLLPDVQQDAVRLMLD


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VKVATDLYTALLNNVQQLKLIKAGKTGSVRVVDTPVIPENVAFPNRSVTIAAGALLGLLLGVGFAFVHNFLFAGIAEADE


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IESHVGLHVYATIPESRHQRQINRNDIDHASDVRLLVEAFPREPAVESLRSMRTALQFAMSNARNNVILISGPSPGVGKS
                                                                      SGPSPGVGKS
                                                                             GKS
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FVSANFAALLATSGKRVLVIDGDLRRGYLHEYFGRQRARGLTDVITGALSLDEVIHRSVVPNLDFIATGVLPPSSAEILM
FVSANFAALLATSGKRVLVIDGDLRRGYLHEYFGRQRARGLTDVITGALSLDEVIHRSVVPNLDFIATGVLPPSSAEILM
                 LVIDGDLR                                                       
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HERVGQLLEDSAHDYDVVLVDSPPVLAAVDAVVLAEHCATVMLVARAGHTRVGELTESVRQFAHAGVAVSGALLNGLDPK
HERVGQLLEDSAHDYDVVLVDSPPVLAAVDAVVLAEHCATVMLVARAGHTRVGELTESVRQFAHAGVAVSGALLNGLDPK
                 VLVDSPP                                                        
       730       740       750       760  
....:....|....:....|....:....|....:....|..
SGRRSYNRKNGGYRYVQYCYEDPRPALTTRWRQLLTRLGQGQ
SGRRSYNRKNGGYRYVQYCYEDPR                  
            YRYVQYCY                      

© 1998-2019