BYKdb

Annotate results for A0A160KVA5

A0A160KVA5 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A160KVA5
DOMAINtad1/142MELRDVLRLLRDHWIPIVAAILLGTLVAFGWSLTQKPRYVADSQGLVSVATGGGGSDDSQ
AIYTQQIAQTVAKSNLATYIPIATSRDVAQIAIDSLGLDVSPATLISAITVQPDTVAPVM
KVSATASTPEGAQKLADAWVSA
DOMAINcd282/471TSPLPSDGKSTVTANLAVTLAASGQRTVVVDGDLRKPTVAKSFGLVPGVGLTDLLIGKAE
LQDVLQPWGPSGNLWVLGAGSIPPNPSELLGSNGMDILLHEIAREAIVIVDAPPLLPVTD
GAILTARTDGALVVISAGKTTTDELGKAIQNLERVSGHTLGVILNRVPARGQVGRGYGYY
YTSYYGSERS
SITE-419/-421GKT
SITEWalker A'309/316VVVDGDLR
SITEWalker B389/395VIVDAPP
SITEY Cluster458/466YGYYYTSYY
SITEWalker A289/291GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MELRDVLRLLRDHWIPIVAAILLGTLVAFGWSLTQKPRYVADSQGLVSVATGGGGSDDSQAIYTQQIAQTVAKSNLATYI
MELRDVLRLLRDHWIPIVAAILLGTLVAFGWSLTQKPRYVADSQGLVSVATGGGGSDDSQAIYTQQIAQTVAKSNLATYI

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PIATSRDVAQIAIDSLGLDVSPATLISAITVQPDTVAPVMKVSATASTPEGAQKLADAWVSAIATKVQQVNQETGVGDTV
PIATSRDVAQIAIDSLGLDVSPATLISAITVQPDTVAPVMKVSATASTPEGAQKLADAWVSA                  

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TLTVLQTAALPSAPAFPNLRLVLAVGALVGLVLGLIYAFVRNTLDRRIRTAEMVERLFDLPVVGTLPVDKRLSETNRIVP


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EADTTDYVKADGKHALAESLRELRTNLQFMNIDSPPRIIVVTSPLPSDGKSTVTANLAVTLAASGQRTVVVDGDLRKPTV
                                         TSPLPSDGKSTVTANLAVTLAASGQRTVVVDGDLRKPTV
                                                GKS                 VVVDGDLR    
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AKSFGLVPGVGLTDLLIGKAELQDVLQPWGPSGNLWVLGAGSIPPNPSELLGSNGMDILLHEIAREAIVIVDAPPLLPVT
AKSFGLVPGVGLTDLLIGKAELQDVLQPWGPSGNLWVLGAGSIPPNPSELLGSNGMDILLHEIAREAIVIVDAPPLLPVT
                                                                    VIVDAPP     
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DGAILTARTDGALVVISAGKTTTDELGKAIQNLERVSGHTLGVILNRVPARGQVGRGYGYYYTSYYGSERSGARPDTAVE
DGAILTARTDGALVVISAGKTTTDELGKAIQNLERVSGHTLGVILNRVPARGQVGRGYGYYYTSYYGSERS         
                                                         YGYYYTSYY              
        
....:...
AEPAPTSA


© 1998-2019