BYKdb

Annotate results for A0A160T936

A0A160T936 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A160T936
DOMAINcd39/215TSPAAGEGKSSTVANLAVTMAQSGRRTVLVDCDLRRPTLHELFGLAMTPGLTSLALDETV
DLPLQETSVENLWLLSSGPKPPNPADLLGAARMGRLIDQLLERADFVLFDAPPVMAAADA
AILGAKVDGVLLVIQAGKTRRDHSERARELLEKANVRIIGATLTNAPQDRSMREYYG
SITE-175/-177GKT
SITEWalker A'66/73VLVDCDLR
SITEWalker B145/151VLFDAPP
SITEY Cluster213/214YY
SITEWalker A46/48GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MALVTISDPRSPASEAYRSLRTNLSFYSLDAPLRTLVVTSPAAGEGKSSTVANLAVTMAQSGRRTVLVDCDLRRPTLHEL
                                      TSPAAGEGKSSTVANLAVTMAQSGRRTVLVDCDLRRPTLHEL
                                             GKS                 VLVDCDLR       
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FGLAMTPGLTSLALDETVDLPLQETSVENLWLLSSGPKPPNPADLLGAARMGRLIDQLLERADFVLFDAPPVMAAADAAI
FGLAMTPGLTSLALDETVDLPLQETSVENLWLLSSGPKPPNPADLLGAARMGRLIDQLLERADFVLFDAPPVMAAADAAI
                                                                VLFDAPP         
       170       180       190       200       210     
....:....|....:....|....:....|....:....|....:....|....:
LGAKVDGVLLVIQAGKTRRDHSERARELLEKANVRIIGATLTNAPQDRSMREYYG
LGAKVDGVLLVIQAGKTRRDHSERARELLEKANVRIIGATLTNAPQDRSMREYYG
                                                    YY 
© 1998-2019