BYKdb

Annotate results for A0A160UA87

A0A160UA87 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A160UA87
DOMAINcd88/269TSPTAGCGKTVTACNLAMSIARLPERSAVVVDLDLRKPMVANYLGLPPSGGVLSVLDGQV
PISSAVIKAGVGPNSLFLLPGSVPTSGSSEWMSSQTMTTLLQAIKREFRSHTVIFDLPPM
LLGDDVISILPRMDAVLLVTGVGSSSVADVKECQKHLERVPVLRVVVNKVSEDVDTYYGS
YY
SITEWalker A95/97GKT
SITEWalker A'116/123VVVDLDLR
SITEWalker B200/206VIFDLPP
SITEY Cluster264/269YYGSYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDSIKQAVELARSGDRLAHQEFIGGSKPIATGQEPASASEVRLDVDHLEANRIVAFATGSESVRYYDMLRTQVLQEMDKK


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NWQFLAITSPTAGCGKTVTACNLAMSIARLPERSAVVVDLDLRKPMVANYLGLPPSGGVLSVLDGQVPISSAVIKAGVGP
       TSPTAGCGKTVTACNLAMSIARLPERSAVVVDLDLRKPMVANYLGLPPSGGVLSVLDGQVPISSAVIKAGVGP
              GKT                  VVVDLDLR                                     
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NSLFLLPGSVPTSGSSEWMSSQTMTTLLQAIKREFRSHTVIFDLPPMLLGDDVISILPRMDAVLLVTGVGSSSVADVKEC
NSLFLLPGSVPTSGSSEWMSSQTMTTLLQAIKREFRSHTVIFDLPPMLLGDDVISILPRMDAVLLVTGVGSSSVADVKEC
                                       VIFDLPP                                  
       250       260         
....:....|....:....|....:....
QKHLERVPVLRVVVNKVSEDVDTYYGSYY
QKHLERVPVLRVVVNKVSEDVDTYYGSYY
                       YYGSYY
© 1998-2019