BYKdb

Annotate results for A0A161GBQ2

A0A161GBQ2 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A161GBQ2
DOMAINtad1/136MRMTVRRYAAALRARWLVIVATTIVGTLIAVVFSLVSTPMYQSTTQFFVTTTAVSSSDVY
QNNLASQQRVVSYTELLTGRELARRVVDQLGLPMSPDELTDRITATAKPNSVLLDASVVD
SSPAQARDIANAIGEL
DOMAINcd268/456TSCIAGEGKSTTAVNLALSLAESGNRVVLVDADLRRPHIADYLGIVGSVGVSSVLAHDAG
LDEVVQTTGHTDLWALGSGPAPPNPSELLGSSTAQSLLRDLGRAFDYVVVDSPPLLPVTD
AATLATQCDGTILVTRYGYTRREELTRAAANLENVGASLLGVVMSMVPATGRGRDQYGYD
FEPGRVPTP
SITEWalker A275/277GKS
SITEWalker A'295/302VLVDADLR
SITEWalker B375/381VVVDSPP
SITE-404/-406YGY
SITEY Cluster444/446YGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MRMTVRRYAAALRARWLVIVATTIVGTLIAVVFSLVSTPMYQSTTQFFVTTTAVSSSDVYQNNLASQQRVVSYTELLTGR
MRMTVRRYAAALRARWLVIVATTIVGTLIAVVFSLVSTPMYQSTTQFFVTTTAVSSSDVYQNNLASQQRVVSYTELLTGR

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ELARRVVDQLGLPMSPDELTDRITATAKPNSVLLDASVVDSSPAQARDIANAIGELFPTLVGELEKPVDGGTASAAVTVA
ELARRVVDQLGLPMSPDELTDRITATAKPNSVLLDASVVDSSPAQARDIANAIGEL                        

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ETAEASTTPVSPKKVRNVALGFVLGLLVGIAGALVRDRMDNTVKEPDELQALTDSVLIGSIPLDKKIRDTPPINFGSSTA


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PIAEAFRQLRMNLKFLSVDNPPRILLVTSCIAGEGKSTTAVNLALSLAESGNRVVLVDADLRRPHIADYLGIVGSVGVSS
                           TSCIAGEGKSTTAVNLALSLAESGNRVVLVDADLRRPHIADYLGIVGSVGVSS
                                  GKS                 VLVDADLR                  
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLAHDAGLDEVVQTTGHTDLWALGSGPAPPNPSELLGSSTAQSLLRDLGRAFDYVVVDSPPLLPVTDAATLATQCDGTIL
VLAHDAGLDEVVQTTGHTDLWALGSGPAPPNPSELLGSSTAQSLLRDLGRAFDYVVVDSPPLLPVTDAATLATQCDGTIL
                                                      VVVDSPP                   
       410       420       430       440       450       460        
....:....|....:....|....:....|....:....|....:....|....:....|....:...
VTRYGYTRREELTRAAANLENVGASLLGVVMSMVPATGRGRDQYGYDFEPGRVPTPPTQSAPVRTNRH
VTRYGYTRREELTRAAANLENVGASLLGVVMSMVPATGRGRDQYGYDFEPGRVPTP            
                                           YGY                      
© 1998-2019