BYKdb

Annotate results for A0A161QKR1

A0A161QKR1 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A161QKR1
DOMAINcd54/233TSSGPGEGKSTTAANLAIVLAQNGNDVLLVDTDLRKPTVHHTFGILNTRGLTNLLMKTEV
IEDVIQTSKVERLSILPSGPIPPNPAELLNSKTMELTLESFKSKYDIIVLDTPPVMAVTD
AQVLGNKVDGSILVVSNGKTDRNQAVKTKELLSQTSSKLLGVVFNNKEVKKGNYYYYYGE
SITE-191/-193GKT
SITEWalker A'81/88LLVDTDLR
SITEWalker B161/167IVLDTPP
SITEY Cluster227/231YYYYY
SITEWalker A61/63GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MYKLARRELKSPTKKRALIANERPKSPITEQYRTIRTNIEFSSVDQELKTLLVTSSGPGEGKSTTAANLAIVLAQNGNDV
                                                     TSSGPGEGKSTTAANLAIVLAQNGNDV
                                                            GKS                 
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLVDTDLRKPTVHHTFGILNTRGLTNLLMKTEVIEDVIQTSKVERLSILPSGPIPPNPAELLNSKTMELTLESFKSKYDI
LLVDTDLRKPTVHHTFGILNTRGLTNLLMKTEVIEDVIQTSKVERLSILPSGPIPPNPAELLNSKTMELTLESFKSKYDI
LLVDTDLR                                                                        
       170       180       190       200       210       220       230   
....:....|....:....|....:....|....:....|....:....|....:....|....:....|...
IVLDTPPVMAVTDAQVLGNKVDGSILVVSNGKTDRNQAVKTKELLSQTSSKLLGVVFNNKEVKKGNYYYYYGE
IVLDTPPVMAVTDAQVLGNKVDGSILVVSNGKTDRNQAVKTKELLSQTSSKLLGVVFNNKEVKKGNYYYYYGE
IVLDTPP                                                           YYYYY  
© 1998-2019