BYKdb

Annotate results for A0A161WDE2

A0A161WDE2 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A161WDE2
DOMAINcd42/230TSSGPGEGKSTTASNLAVVMAESGSKTILIDCDQRKPRLHKVFLTTNERGISDLLVGKVK
FEEAVQETKVPNLSILTSGTRPPNPSELLGSSKMRAFIDALKERYEYIIIDTPPIIAVTD
AQLLASHADGSLLVIASSQAEREAAVKAKELLQKVNAKILGVVLNKLEVQEKGYYGYYYH
YYYGNDGGK
SITEWalker A49/51GKS
SITEWalker A'69/76ILIDCDQR
SITEWalker B149/155IIIDTPP
SITE-146/-148YEY
SITEY Cluster215/224YYGYYYHYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MEKPDIISVKSPKSPIAEAYRTLRTNIQFSSFDNKIQTIVVTSSGPGEGKSTTASNLAVVMAESGSKTILIDCDQRKPRL
                                         TSSGPGEGKSTTASNLAVVMAESGSKTILIDCDQRKPRL
                                                GKS                 ILIDCDQR    
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HKVFLTTNERGISDLLVGKVKFEEAVQETKVPNLSILTSGTRPPNPSELLGSSKMRAFIDALKERYEYIIIDTPPIIAVT
HKVFLTTNERGISDLLVGKVKFEEAVQETKVPNLSILTSGTRPPNPSELLGSSKMRAFIDALKERYEYIIIDTPPIIAVT
                                                                    IIIDTPP     
       170       180       190       200       210       220       230       
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:..
DAQLLASHADGSLLVIASSQAEREAAVKAKELLQKVNAKILGVVLNKLEVQEKGYYGYYYHYYYGNDGGKKKKKKGK
DAQLLASHADGSLLVIASSQAEREAAVKAKELLQKVNAKILGVVLNKLEVQEKGYYGYYYHYYYGNDGGK       
                                                      YYGYYYHYYY             
© 1998-2019