BYKdb

Annotate results for A0A161XBF9

A0A161XBF9 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A161XBF9
DOMAINtad13/178DTINLRLVFQYLRNYWALVLGVTGVVTILGVTLAFFAAPKYTAVTSVYIETRAENVVDVK
AILSGFGSDNKLLQSQIEIIGSNGVAKRVINDHDLENSAEFRQVPSYLAEILEKITGEPP
ATTSLEQRVLDGLHVTLNRNTTVVDLSYQAGTPEMAAELADGFAEA
DOMAINcd549/737TSAIPGEGKSTISRNLAHYTAKAGERVLFIDADMRRQISADAPGDQKEKSLADVLTGKVT
FAEATKHEEGSNLYYLPAPSHRELWETAELLSSKAMKTLLDGASKSFDLVIIDSPPTLPL
IDSRVLSHVVDATVLVASWNHTDGGLVEQAKELLDQTPGKTLGVILNNFDVSKAKLNKHQ
ASYGYGYYK
SITEWalker A556/558GKS
SITEWalker A'576/583LFIDADMR
SITEWalker B658/664VIIDSPP
SITE-622/-623YY
SITE-707/-709GKT
SITEY Cluster731/736YGYGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MQNSLASNATPEDTINLRLVFQYLRNYWALVLGVTGVVTILGVTLAFFAAPKYTAVTSVYIETRAENVVDVKAILSGFGS
            DTINLRLVFQYLRNYWALVLGVTGVVTILGVTLAFFAAPKYTAVTSVYIETRAENVVDVKAILSGFGS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DNKLLQSQIEIIGSNGVAKRVINDHDLENSAEFRQVPSYLAEILEKITGEPPATTSLEQRVLDGLHVTLNRNTTVVDLSY
DNKLLQSQIEIIGSNGVAKRVINDHDLENSAEFRQVPSYLAEILEKITGEPPATTSLEQRVLDGLHVTLNRNTTVVDLSY

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QAGTPEMAAELADGFAEAYLADKLATKFDSIRQASEWLSIRLAELGVKVRSSEQAVEQFRNEFNLQLAGSGTINEKQIAT
QAGTPEMAAELADGFAEA                                                              

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LNQQLVFARTKTAESQARVDQIEKVLVRGGSTSSFADAAQSAVITQLRAKASEVERKEAALTVKYSHKHPAVVSVRSQLT


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DLRAQIEKELQRIVDTAQNELAVAQRREASIAGSLEELRDVTNTENHAQVYLRELVREAAANRTLYESFLARLKETQEFE


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KMNSVSSRILSPAEIPSNASFPNKKLFLLVSAVLGLIIGTALALLIEQFDNTLKSKEDVEKRIGLPLFSQVPLIDGHASA


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SRLKTFFSFFGSKHASTARGAKNNDALSNEITHFASENPLSHYAESIRELRSRVKFSRLDNPIKTLLITSAIPGEGKSTI
                                                                    TSAIPGEGKSTI
                                                                           GKS  
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SRNLAHYTAKAGERVLFIDADMRRQISADAPGDQKEKSLADVLTGKVTFAEATKHEEGSNLYYLPAPSHRELWETAELLS
SRNLAHYTAKAGERVLFIDADMRRQISADAPGDQKEKSLADVLTGKVTFAEATKHEEGSNLYYLPAPSHRELWETAELLS
               LFIDADMR                                                         
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SKAMKTLLDGASKSFDLVIIDSPPTLPLIDSRVLSHVVDATVLVASWNHTDGGLVEQAKELLDQTPGKTLGVILNNFDVS
SKAMKTLLDGASKSFDLVIIDSPPTLPLIDSRVLSHVVDATVLVASWNHTDGGLVEQAKELLDQTPGKTLGVILNNFDVS
                 VIIDSPP                                                        
       730       
....:....|....:..
KAKLNKHQASYGYGYYK
KAKLNKHQASYGYGYYK
          YGYGYY 

© 1998-2019