BYKdb

Annotate results for A0A161ZE47

A0A161ZE47 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A161ZE47
DOMAINtad28/216DTIDLLKYWRVIWRAHWKIGWLIVLGCVLAMVTLSFIPSQYIGSTTLLIKEKTPPLLAFQ
QVTDSSSGTVDYLQTQLALLQSRDLAERAVRKLNLTTHPVTDPRQQPQPWFAPRKWLATL
ELGQWLPVLGRLAPMQVVPSEAEVFNQVTQNLMRQTRVKFVGKSQLIKIEVELPDPGLAA
ATANAIAQG
DOMAINcd560/748ASTMAEEGKSTIANNLAYSLAKLERVLLIDADMRRPSLSLNFDFPTDSPGLANVLAGTAR
LEDCIRSVGNLDMLPAGKLSPPPLDLLGSSRLAPMLEALKSRYQRIIIDSPPAQMVSDAL
LLAKHSDAVIYVIKAQSTPVSEVQKCLANLQQCHAPVFGVVLNQVDLSKARKQGYSHSDT
FQNYDYLPR
SITEWalker A567/569GKS
SITEWalker A'586/593LLIDADMR
SITEWalker B665/671IIIDSPP
SITEY Cluster743/745YDY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDNSPSLYVERPLQAHVPQHQQYSEEKDTIDLLKYWRVIWRAHWKIGWLIVLGCVLAMVTLSFIPSQYIGSTTLLIKEKT
                           DTIDLLKYWRVIWRAHWKIGWLIVLGCVLAMVTLSFIPSQYIGSTTLLIKEKT

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PPLLAFQQVTDSSSGTVDYLQTQLALLQSRDLAERAVRKLNLTTHPVTDPRQQPQPWFAPRKWLATLELGQWLPVLGRLA
PPLLAFQQVTDSSSGTVDYLQTQLALLQSRDLAERAVRKLNLTTHPVTDPRQQPQPWFAPRKWLATLELGQWLPVLGRLA

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PMQVVPSEAEVFNQVTQNLMRQTRVKFVGKSQLIKIEVELPDPGLAAATANAIAQGFIDSQLDNSLKSSLTNTSWMNSRL
PMQVVPSEAEVFNQVTQNLMRQTRVKFVGKSQLIKIEVELPDPGLAAATANAIAQG                        

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IELRNNLRSAEDKLQAYREAQGLVDVGGVATISANELELTGNRMIDARRNLAEAESQFRQVQALSNGNLSKLSSVPAVLS


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NPLVQKFQAQQAKAQAKVEELSGRYGPKHPTLAAARAELRTATDSLRLQVQQVVAGIEREYQLSQANEHSLRKSFNSNKA


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QLQDISRKEFQLREFQREVDSSRALYETFITRLKETAATSDMDSTKARIVDPAIAPLEPSKPRKTLILAIVAVVAALIGV


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ALALLSETLNKTFKSDEAIESTLDVPLLSVVPLVMRKSRRQLARLFDDNDHPRFCETIRNLRTWLMLHGGDMPSQVVLVA
                                                                               A

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
STMAEEGKSTIANNLAYSLAKLERVLLIDADMRRPSLSLNFDFPTDSPGLANVLAGTARLEDCIRSVGNLDMLPAGKLSP
STMAEEGKSTIANNLAYSLAKLERVLLIDADMRRPSLSLNFDFPTDSPGLANVLAGTARLEDCIRSVGNLDMLPAGKLSP
      GKS                LLIDADMR                                               
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PPLDLLGSSRLAPMLEALKSRYQRIIIDSPPAQMVSDALLLAKHSDAVIYVIKAQSTPVSEVQKCLANLQQCHAPVFGVV
PPLDLLGSSRLAPMLEALKSRYQRIIIDSPPAQMVSDALLLAKHSDAVIYVIKAQSTPVSEVQKCLANLQQCHAPVFGVV
                        IIIDSPP                                                 
       730       740        
....:....|....:....|....:...
LNQVDLSKARKQGYSHSDTFQNYDYLPR
LNQVDLSKARKQGYSHSDTFQNYDYLPR
                      YDY   

© 1998-2019