BYKdb

Annotate results for A0A162RDJ9

A0A162RDJ9 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A162RDJ9
DOMAINcd42/229TSSGPSEGKSTTSSNLAVVMAQNGNKTILIDCDQRKPKLHKVFLTSNQKGLSDLLVGNSV
FEEAVEKTEIENLDILTSGTRPPNPSELLASTKMKNFIENLREKYDCIIIDTPPVIAVTD
AQIVSRYADGCLLVVASAQAEREAAMKAKELLVKVDAKIIGVVLNKLDIKEKGYYGYYYT
DYSDEGEK
SITEWalker A49/51GKS
SITEWalker A'69/76ILIDCDQR
SITEWalker B149/155IIIDTPP
SITEY Cluster215/223YYGYYYTDY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MENIDIITIKNPRSPIAESYRTLRTNIQFSSFDKKIQTIVITSSGPSEGKSTTSSNLAVVMAQNGNKTILIDCDQRKPKL
                                         TSSGPSEGKSTTSSNLAVVMAQNGNKTILIDCDQRKPKL
                                                GKS                 ILIDCDQR    
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HKVFLTSNQKGLSDLLVGNSVFEEAVEKTEIENLDILTSGTRPPNPSELLASTKMKNFIENLREKYDCIIIDTPPVIAVT
HKVFLTSNQKGLSDLLVGNSVFEEAVEKTEIENLDILTSGTRPPNPSELLASTKMKNFIENLREKYDCIIIDTPPVIAVT
                                                                    IIIDTPP     
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DAQIVSRYADGCLLVVASAQAEREAAMKAKELLVKVDAKIIGVVLNKLDIKEKGYYGYYYTDYSDEGEKKTVKRRSRKNK
DAQIVSRYADGCLLVVASAQAEREAAMKAKELLVKVDAKIIGVVLNKLDIKEKGYYGYYYTDYSDEGEK           
                                                      YYGYYYTDY                 
       250       
....:....|....:..
KQRLSLSFFSRLKKSVN


© 1998-2019