BYKdb

Annotate results for A0A163UNQ6

A0A163UNQ6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A163UNQ6
DOMAINcd275/467TSAGPREGKSTTSANLAVAFAQSGRRCILVDADLRRPVIHNIFGLDREPGLSEAAAGVTP
LAECVRKTSIDNLSILPSGFIPHNPSELLGSRRMKDVIAGLTAECDMLIIDSPPMAVVTD
ALLLSPEVDGTLLVVGAKLGNRRVLQTSLSRLSRTSSFIVGAVLNGFDPLRMYTSYGYYT
YRYYYPYYNPEGQ
SITEWalker A282/284GKS
SITEWalker A'302/309ILVDADLR
SITEWalker B382/388LIIDSPP
SITEY Cluster447/462YTSYGYYTYRYYYPYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAGEIASINDSYIDTLQEELALLEASRATLLARGAQPDDPALTELEEEISIRTEALSSSLEGLVRARYPENPSAAVQSLV


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GEIIRVEADLRAETTRESVLRAQASSLESDLSRLPAAEMNLARLQRNRLVSENVYLLLRNKYEEIRIAEAGQIGNVTIID


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TALPGNMIRPSRRKNLMMGLLVGLALGLGTVFLKQQLDTSISSPEQVEALGVSILGVIPHLPKSALASRASRTVPSSTLV


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
THFAPRDPISEAYRDLRTSLKFARADQPLESILITSAGPREGKSTTSANLAVAFAQSGRRCILVDADLRRPVIHNIFGLD
                                  TSAGPREGKSTTSANLAVAFAQSGRRCILVDADLRRPVIHNIFGLD
                                         GKS                 ILVDADLR           
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
REPGLSEAAAGVTPLAECVRKTSIDNLSILPSGFIPHNPSELLGSRRMKDVIAGLTAECDMLIIDSPPMAVVTDALLLSP
REPGLSEAAAGVTPLAECVRKTSIDNLSILPSGFIPHNPSELLGSRRMKDVIAGLTAECDMLIIDSPPMAVVTDALLLSP
                                                             LIIDSPP            
       410       420       430       440       450       460       470      
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:.
EVDGTLLVVGAKLGNRRVLQTSLSRLSRTSSFIVGAVLNGFDPLRMYTSYGYYTYRYYYPYYNPEGQGRGKGRRTR
EVDGTLLVVGAKLGNRRVLQTSLSRLSRTSSFIVGAVLNGFDPLRMYTSYGYYTYRYYYPYYNPEGQ         
                                              YTSYGYYTYRYYYPYY              
© 1998-2019