BYKdb

Annotate results for A0A164BG91

A0A164BG91 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A164BG91
DOMAINtad4/143TQSAATRLPSVFLQLWWVIVVAGVVGGLAAFGYSSTLTPVFHSTASIYFSMRTASSGSDI
NQGSAYTQNQMLSFAQLATSAAVLDEVRDDLAGTRPDLTLTDLRRMTKVEIPQNTVVLEI
TAASANPEFAAEVGNSIADN
DOMAINcd274/453TSSVAGEGKTTTAVNLALAYVESGQRVLLIDADLRRPTVATTLGLENAVGLTSVLVEAVE
AEDAIIESAGGLAVLTAGEPAPNPAELLASNRMRLLVEALRPSYDLVVIDTAPVLSVSDA
TVISQYVDATIAIINTRKTAKTQVERCIAALTGVRANLAGFVLNNVAEARRDRYYYLSEN
SITEWalker A281/283GKT
SITEWalker A'301/308LLIDADLR
SITEWalker B380/386VVIDTAP
SITEY Cluster447/449YYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSTTQSAATRLPSVFLQLWWVIVVAGVVGGLAAFGYSSTLTPVFHSTASIYFSMRTASSGSDINQGSAYTQNQMLSFAQL
   TQSAATRLPSVFLQLWWVIVVAGVVGGLAAFGYSSTLTPVFHSTASIYFSMRTASSGSDINQGSAYTQNQMLSFAQL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ATSAAVLDEVRDDLAGTRPDLTLTDLRRMTKVEIPQNTVVLEITAASANPEFAAEVGNSIADNLTQAVYTIAPKDDKGES
ATSAAVLDEVRDDLAGTRPDLTLTDLRRMTKVEIPQNTVVLEITAASANPEFAAEVGNSIADN                 

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TVVARVIDPAVPATVQSSPNKSQNAVIGVLIGALLAALALSAWALLDTRVRSRNALAEVTDLPVLGAVPRQKGKPSGPVV


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LTKPNGHGAEAYRQVRSALKFSAVEHRIGAIAVTSSVAGEGKTTTAVNLALAYVESGQRVLLIDADLRRPTVATTLGLEN
                                 TSSVAGEGKTTTAVNLALAYVESGQRVLLIDADLRRPTVATTLGLEN
                                        GKT                 LLIDADLR            
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AVGLTSVLVEAVEAEDAIIESAGGLAVLTAGEPAPNPAELLASNRMRLLVEALRPSYDLVVIDTAPVLSVSDATVISQYV
AVGLTSVLVEAVEAEDAIIESAGGLAVLTAGEPAPNPAELLASNRMRLLVEALRPSYDLVVIDTAPVLSVSDATVISQYV
                                                           VVIDTAP              
       410       420       430       440       450   
....:....|....:....|....:....|....:....|....:....|...
DATIAIINTRKTAKTQVERCIAALTGVRANLAGFVLNNVAEARRDRYYYLSEN
DATIAIINTRKTAKTQVERCIAALTGVRANLAGFVLNNVAEARRDRYYYLSEN
                                              YYY    
© 1998-2019