BYKdb

Annotate results for A0A165H699

A0A165H699 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A165H699
DOMAINcd55/238TSALPGDGKSTISANLATLFAQDGKRVLFIDADMRKPTVQYTFSLTNAAGLSTVLTQQRL
AGEVIRESEISPNLHIMTSGPIPPNPAELLGSRSMAVLMNEMAQQYDLIVFDAPPVLSVT
DAQLLANKVDGTLLVVNTGVTEKENIEKAKEQLGNAQARILGAVMNNFEMDKDHYYYQYY
GTEE
SITEWalker A62/64GKS
SITEWalker A'82/89LFIDADMR
SITEWalker B163/169IVFDAPP
SITEY Cluster229/234YYYQYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MARRKKSSKKQLEQRARKLVVAANPRSVVSEQFRTLRSNITFSAVDKEMKTILVTSALPGDGKSTISANLATLFAQDGKR
                                                      TSALPGDGKSTISANLATLFAQDGKR
                                                             GKS                
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLFIDADMRKPTVQYTFSLTNAAGLSTVLTQQRLAGEVIRESEISPNLHIMTSGPIPPNPAELLGSRSMAVLMNEMAQQY
VLFIDADMRKPTVQYTFSLTNAAGLSTVLTQQRLAGEVIRESEISPNLHIMTSGPIPPNPAELLGSRSMAVLMNEMAQQY
 LFIDADMR                                                                       
       170       180       190       200       210       220       230        
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:...
DLIVFDAPPVLSVTDAQLLANKVDGTLLVVNTGVTEKENIEKAKEQLGNAQARILGAVMNNFEMDKDHYYYQYYGTEE
DLIVFDAPPVLSVTDAQLLANKVDGTLLVVNTGVTEKENIEKAKEQLGNAQARILGAVMNNFEMDKDHYYYQYYGTEE
  IVFDAPP                                                           YYYQYY    
© 1998-2019