BYKdb

Annotate results for A0A165I7L3

A0A165I7L3 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A165I7L3
DOMAINtad1/136MDMQRVARILRAYWKTIVALTIIGGLAGLAWSALQPRVYTADASGYVASVSSDGSTGAAL
AGDTLALSKVKSFIDMGYWRAVAETARDELGIADSPESLVERVHVSNPVDTVNVRVEATG
PTPESARDLAQAWLHG
DOMAINcd273/465TSPLPGDGKSTTASNLAVSIAATGQSVILIDADLRRPVLGATFGFSDDVGLSDVLAGRAR
IDQVAHQVDEHGRLFIVAAGRTPPNPSEMVGSQRMQQLARGLADDMVVIIDSPPTLAVAD
AAVIASWADGAVLVVTAGRTTDDMLVRAVGNIAKTRGRLLGVVLNRVPLRGVDSSYYGTQ
YGGYYGYGVPTSG
SITEWalker A280/282GKS
SITEWalker A'300/307ILIDADLR
SITEWalker B380/386VIIDSPP
SITEY Cluster448/459YYGTQYGGYYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDMQRVARILRAYWKTIVALTIIGGLAGLAWSALQPRVYTADASGYVASVSSDGSTGAALAGDTLALSKVKSFIDMGYWR
MDMQRVARILRAYWKTIVALTIIGGLAGLAWSALQPRVYTADASGYVASVSSDGSTGAALAGDTLALSKVKSFIDMGYWR

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AVAETARDELGIADSPESLVERVHVSNPVDTVNVRVEATGPTPESARDLAQAWLHGMTVQVDQLESTGGGRGAVRLVAGD
AVAETARDELGIADSPESLVERVHVSNPVDTVNVRVEATGPTPESARDLAQAWLHG                        

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SARLPSAPSSPNVKLDVAVGAIVGAVAGVVFALVRRAFDRRVRSARDISDAVDASVVGILPVDKELAAGRAVFSFDDIRD


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GRGSFAHKEAVRELRTNLQYVDVDHPARVMVVTSPLPGDGKSTTASNLAVSIAATGQSVILIDADLRRPVLGATFGFSDD
                                TSPLPGDGKSTTASNLAVSIAATGQSVILIDADLRRPVLGATFGFSDD
                                       GKS                 ILIDADLR             
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VGLSDVLAGRARIDQVAHQVDEHGRLFIVAAGRTPPNPSEMVGSQRMQQLARGLADDMVVIIDSPPTLAVADAAVIASWA
VGLSDVLAGRARIDQVAHQVDEHGRLFIVAAGRTPPNPSEMVGSQRMQQLARGLADDMVVIIDSPPTLAVADAAVIASWA
                                                           VIIDSPP              
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DGAVLVVTAGRTTDDMLVRAVGNIAKTRGRLLGVVLNRVPLRGVDSSYYGTQYGGYYGYGVPTSGAARTVWWRRLLRRGE
DGAVLVVTAGRTTDDMLVRAVGNIAKTRGRLLGVVLNRVPLRGVDSSYYGTQYGGYYGYGVPTSG               
                                               YYGTQYGGYYGY                     
       490       500       510       520       530       540       550 
....:....|....:....|....:....|....:....|....:....|....:....|....:....|.
SATPGADEAAPGPRRRSTDLPPDNVSGLRTLSPRRNVPALPGDPGREGREAAGTAPQSARDDLPSRRRQRG


© 1998-2019