BYKdb

Annotate results for A0A165R6Z3

A0A165R6Z3 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A165R6Z3
DOMAINcd43/226TSAIQGEGKSTVGSNLAVEYAKKGLQVLLVDADLRRPTIHQTFAISNQRGVSSWLSGQLT
DVNEAIYPVLDHLFVMPSGPKPPNPAELLASDRMTEFLTVTTRKLDLVIVDAPPILPVTD
ARILAGQVDGTVLVVRQNFVEKVAVRQAVSALKNARAQLLGTILNDVDIKTHGYGYGYYG
TETN
SITEWalker A50/52GKS
SITEWalker A'70/77LLVDADLR
SITEWalker B150/156VIVDAPP
SITEY Cluster216/221YGYGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MHTGIQLTTLTAPMSVVTEQVKTIRTNLNYAMVGKPLKTLMITSAIQGEGKSTVGSNLAVEYAKKGLQVLLVDADLRRPT
                                          TSAIQGEGKSTVGSNLAVEYAKKGLQVLLVDADLRRPT
                                                 GKS                 LLVDADLR   
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IHQTFAISNQRGVSSWLSGQLTDVNEAIYPVLDHLFVMPSGPKPPNPAELLASDRMTEFLTVTTRKLDLVIVDAPPILPV
IHQTFAISNQRGVSSWLSGQLTDVNEAIYPVLDHLFVMPSGPKPPNPAELLASDRMTEFLTVTTRKLDLVIVDAPPILPV
                                                                     VIVDAPP    
       170       180       190       200       210       220      
....:....|....:....|....:....|....:....|....:....|....:....|....:.
TDARILAGQVDGTVLVVRQNFVEKVAVRQAVSALKNARAQLLGTILNDVDIKTHGYGYGYYGTETN
TDARILAGQVDGTVLVVRQNFVEKVAVRQAVSALKNARAQLLGTILNDVDIKTHGYGYGYYGTETN
                                                       YGYGYY     
© 1998-2019