BYKdb

Annotate results for A0A165S9S6

A0A165S9S6 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A165S9S6
DOMAINtad1/155MERYWHEAIGLKYWLAGIITLGLLIGVLVTLLATPLYQASARLEVSQVTADVTNLDLLEV
DSQVSELQYLNTQYELLVSKFMAKRVMDAGNLSRDEAFREAFGVEEGGGQNRNIEQILFD
NVSIAPIAQSSLVDVTFSSPDPVVSAEITNLWVRE
DOMAINcd481/673TSSVPSEGKSISSLGVATSFAQLGKRVLLIDADLRNSKLRETLNLHEYDKGGLVPLLANQ
QTDMGSQIIHLEDFGFDFLPMGRTPPNPVELLAGDRFSQIVEAARGQYDQVLIDGAPMLA
LADAIEMSKAVDGVIFVIQTERIKLRGIENALGRLQRSGAKVYGAIVTKVSQNNSAYGYG
YGYGYGYGYGYGE
SITEWalker A488/490GKS
SITEWalker A'508/515LLIDADLR
SITEWalker B591/597VLIDGAP
SITEY Cluster657/671YGYGYGYGYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MERYWHEAIGLKYWLAGIITLGLLIGVLVTLLATPLYQASARLEVSQVTADVTNLDLLEVDSQVSELQYLNTQYELLVSK
MERYWHEAIGLKYWLAGIITLGLLIGVLVTLLATPLYQASARLEVSQVTADVTNLDLLEVDSQVSELQYLNTQYELLVSK

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FMAKRVMDAGNLSRDEAFREAFGVEEGGGQNRNIEQILFDNVSIAPIAQSSLVDVTFSSPDPVVSAEITNLWVREFVAAN
FMAKRVMDAGNLSRDEAFREAFGVEEGGGQNRNIEQILFDNVSIAPIAQSSLVDVTFSSPDPVVSAEITNLWVRE     

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YEKRFGANIEARDFLQSQIAELRERLSDSERELVEYANANEILVLNAGGESGSESAGQTLVGADLQALNMALATAVADRV


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SAQAAVVGGNFPNGDPRNQLLASLSEAEAELAILRANFGPEYPEVQEKQAEVDSLRSAISGGARGLLRSARIREAELREQ


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VEQVKQRFLSQQGQGISYGILKREVDTNREIYDALLQRFKELEASGAGQNNIQIIDEASVPTEPYAPSLIMNVLVSVIVS


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLAASGLVYLKVALSQTLKDPEDVRRRLHLALLGAIPRINEGAMVDRITERSSHINEAYTTVRTNMNFLTPQGAPEVLMF


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TSSVPSEGKSISSLGVATSFAQLGKRVLLIDADLRNSKLRETLNLHEYDKGGLVPLLANQQTDMGSQIIHLEDFGFDFLP
TSSVPSEGKSISSLGVATSFAQLGKRVLLIDADLRNSKLRETLNLHEYDKGGLVPLLANQQTDMGSQIIHLEDFGFDFLP
       GKS                 LLIDADLR                                             
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MGRTPPNPVELLAGDRFSQIVEAARGQYDQVLIDGAPMLALADAIEMSKAVDGVIFVIQTERIKLRGIENALGRLQRSGA
MGRTPPNPVELLAGDRFSQIVEAARGQYDQVLIDGAPMLALADAIEMSKAVDGVIFVIQTERIKLRGIENALGRLQRSGA
                              VLIDGAP                                           
       650       660       670       680
....:....|....:....|....:....|....:....|
KVYGAIVTKVSQNNSAYGYGYGYGYGYGYGYGEERDAEPA
KVYGAIVTKVSQNNSAYGYGYGYGYGYGYGYGE       
                YGYGYGYGYGYGYGY         
© 1998-2019