BYKdb

Annotate results for A0A165VAR0

A0A165VAR0 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A165VAR0
DOMAINcd46/229TSAVQGEGKSTIGGNLAVEYAKKGMQVLLVDADLRRPTIHQTFGVSNQRGLSSWLSGQLV
DVNDAIHPVLDHLFVMPSGPKPPNPAELLASDKMTEFLTVATRKLDLVIVDAPPVLPVTD
ARILAGQVDGTVLVVRQNFVEKVAVRQAVNALKNARTQLLGTVLNDVDIKTNGYGYGYYG
TDTN
SITEWalker A53/55GKS
SITEWalker A'73/80LLVDADLR
SITEWalker B153/159VIVDAPP
SITEY Cluster219/224YGYGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTNMSTSIQLTALTAPMSVVTEQIKTIRTNLNYSMVGKPLKTLMITSAVQGEGKSTIGGNLAVEYAKKGMQVLLVDADLR
                                             TSAVQGEGKSTIGGNLAVEYAKKGMQVLLVDADLR
                                                    GKS                 LLVDADLR
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RPTIHQTFGVSNQRGLSSWLSGQLVDVNDAIHPVLDHLFVMPSGPKPPNPAELLASDKMTEFLTVATRKLDLVIVDAPPV
RPTIHQTFGVSNQRGLSSWLSGQLVDVNDAIHPVLDHLFVMPSGPKPPNPAELLASDKMTEFLTVATRKLDLVIVDAPPV
                                                                        VIVDAPP 
       170       180       190       200       210       220         
....:....|....:....|....:....|....:....|....:....|....:....|....:....
LPVTDARILAGQVDGTVLVVRQNFVEKVAVRQAVNALKNARTQLLGTVLNDVDIKTNGYGYGYYGTDTN
LPVTDARILAGQVDGTVLVVRQNFVEKVAVRQAVNALKNARTQLLGTVLNDVDIKTNGYGYGYYGTDTN
                                                          YGYGYY     
© 1998-2019