BYKdb

Annotate results for A0A165WR08

A0A165WR08 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A165WR08
DOMAINcd51/232TSTGPGEGKSTTAANLAVVFAQQGKQVLLIDADLRKPTVHYTFRLQNIHGLTSVLLRNAT
LQEAVSVSEVDHLDVLTSGPIPPNPAELLSSRSMVELLKEAYDQYDIVIIDSPPLLAVAD
AQILANQVDASIMVVASGKTEREAALKGKESLIAAQSKLLGVVLNGKPQKDSHYYYYYGG
KN
SITE-188/-190GKT
SITEWalker A'78/85LLIDADLR
SITEWalker B158/164VIIDSPP
SITE-152/-155YDQY
SITEY Cluster224/228YYYYY
SITEWalker A58/60GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAPRAKGMKQKQRTLITALNPKSPISEQYRTIRTNIQFSSVDHEIRSIMITSTGPGEGKSTTAANLAVVFAQQGKQVLLI
                                                  TSTGPGEGKSTTAANLAVVFAQQGKQVLLI
                                                         GKS                 LLI
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DADLRKPTVHYTFRLQNIHGLTSVLLRNATLQEAVSVSEVDHLDVLTSGPIPPNPAELLSSRSMVELLKEAYDQYDIVII
DADLRKPTVHYTFRLQNIHGLTSVLLRNATLQEAVSVSEVDHLDVLTSGPIPPNPAELLSSRSMVELLKEAYDQYDIVII
DADLR                                                                        VII
       170       180       190       200       210       220       230  
....:....|....:....|....:....|....:....|....:....|....:....|....:....|..
DSPPLLAVADAQILANQVDASIMVVASGKTEREAALKGKESLIAAQSKLLGVVLNGKPQKDSHYYYYYGGKN
DSPPLLAVADAQILANQVDASIMVVASGKTEREAALKGKESLIAAQSKLLGVVLNGKPQKDSHYYYYYGGKN
DSPP                                                           YYYYY    
© 1998-2019