BYKdb

Annotate results for A0A166AYJ7

A0A166AYJ7 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A166AYJ7
DOMAINcd54/234TSAGPGEGKSTTAANLAIVFAQQGKDVLLVDADMRKPTMHYTFNFTNTIGLTNVLAKQKS
ISTAVKETEIQNLSVLLSGPIPPNPAELLGSRVMAEFLQEACRLYDLVIFDTPPVLAVTD
AQVLANQCDGTVFVVNSGQTEVDSAVKAKELLQAAKAKLLGVVLNNRKIKETNHYYYYGN
K
SITEWalker A61/63GKS
SITEWalker A'81/88LLVDADMR
SITEWalker B161/167VIFDTPP
SITEY Cluster228/231YYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MVLKKQKHKSLGQTKRKLITDVDPKSPISEQYRTIRTNILFSAVDRDIQSLLITSAGPGEGKSTTAANLAIVFAQQGKDV
                                                     TSAGPGEGKSTTAANLAIVFAQQGKDV
                                                            GKS                 
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLVDADMRKPTMHYTFNFTNTIGLTNVLAKQKSISTAVKETEIQNLSVLLSGPIPPNPAELLGSRVMAEFLQEACRLYDL
LLVDADMRKPTMHYTFNFTNTIGLTNVLAKQKSISTAVKETEIQNLSVLLSGPIPPNPAELLGSRVMAEFLQEACRLYDL
LLVDADMR                                                                        
       170       180       190       200       210       220       230    
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....
VIFDTPPVLAVTDAQVLANQCDGTVFVVNSGQTEVDSAVKAKELLQAAKAKLLGVVLNNRKIKETNHYYYYGNK
VIFDTPPVLAVTDAQVLANQCDGTVFVVNSGQTEVDSAVKAKELLQAAKAKLLGVVLNNRKIKETNHYYYYGNK
VIFDTPP                                                            YYYY   
© 1998-2019