BYKdb

Annotate results for A0A166FN74

A0A166FN74 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A166FN74
DOMAINcd57/244TSSGMSEGKSTVSANTAVTWAQQGKKILFIDADLRRPSVQSSFDLVNGRGLSSVLSNNLD
FHEVTQQTAIDNLEVITSGPIPPNPAELLNSNRMKRLLDSVEAEYDLVLLDVPPLLSVTD
TQVLAARVDGVVLVVRQGVAQKTAITRAVELLQMVHANLLGYVLNDMVPRDGYGYGYGYG
YGYGYGHE
SITEWalker A64/66GKS
SITEWalker A'84/91LFIDADLR
SITEWalker B164/170VLLDVPP
SITEY Cluster229/241YGYGYGYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MALFRRKKKQSDDSIINGVKLVTAVEPKNVVSEQFRTVRTNIDFSSVDKQIKTLLFTSSGMSEGKSTVSANTAVTWAQQG
                                                        TSSGMSEGKSTVSANTAVTWAQQG
                                                               GKS              
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KKILFIDADLRRPSVQSSFDLVNGRGLSSVLSNNLDFHEVTQQTAIDNLEVITSGPIPPNPAELLNSNRMKRLLDSVEAE
KKILFIDADLRRPSVQSSFDLVNGRGLSSVLSNNLDFHEVTQQTAIDNLEVITSGPIPPNPAELLNSNRMKRLLDSVEAE
   LFIDADLR                                                                     
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YDLVLLDVPPLLSVTDTQVLAARVDGVVLVVRQGVAQKTAITRAVELLQMVHANLLGYVLNDMVPRDGYGYGYGYGYGYG
YDLVLLDVPPLLSVTDTQVLAARVDGVVLVVRQGVAQKTAITRAVELLQMVHANLLGYVLNDMVPRDGYGYGYGYGYGYG
   VLLDVPP                                                          YGYGYGYGYGYG
    
....
YGHE
YGHE
Y   
© 1998-2019