BYKdb

Annotate results for A0A166HK45

A0A166HK45 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A166HK45
DOMAINcd58/243TSSAVSEGKSTVSANLAVIWAQQGQKVLFIDSDLRRPTLHTTFGLLNTSGLSTALSTDID
FNSVVQKTEIDDLSVITSGPIPPNPSDLLASNRMKELIFYFKTTYDVIILDVPPLLSVTD
TQIIAAQVDGVVLVVRQGLAQKLAIKRSTELLKMVKANLLGYVLNDVAPKNGYGYGYGYG
YDNKHE
SITEWalker A65/67GKS
SITEWalker A'85/92LFIDSDLR
SITEWalker B165/171IILDVPP
SITE-157/-162YFKTTY
SITEY Cluster230/238YGYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNIFHHQRKKLSTDTLRNGVKLITDVDPKDVVSEQFRTVRTNINFSAVNQKLKTIIFTSSAVSEGKSTVSANLAVIWAQQ
                                                         TSSAVSEGKSTVSANLAVIWAQQ
                                                                GKS             
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GQKVLFIDSDLRRPTLHTTFGLLNTSGLSTALSTDIDFNSVVQKTEIDDLSVITSGPIPPNPSDLLASNRMKELIFYFKT
GQKVLFIDSDLRRPTLHTTFGLLNTSGLSTALSTDIDFNSVVQKTEIDDLSVITSGPIPPNPSDLLASNRMKELIFYFKT
    LFIDSDLR                                                                    
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TYDVIILDVPPLLSVTDTQIIAAQVDGVVLVVRQGLAQKLAIKRSTELLKMVKANLLGYVLNDVAPKNGYGYGYGYGYDN
TYDVIILDVPPLLSVTDTQIIAAQVDGVVLVVRQGLAQKLAIKRSTELLKMVKANLLGYVLNDVAPKNGYGYGYGYGYDN
    IILDVPP                                                          YGYGYGYGY  
   
...
KHE
KHE

© 1998-2019