BYKdb

Annotate results for A0A166W711

A0A166W711 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A166W711
DOMAINtad17/191EVIDLSYYWHVVRRQLKMIIALSIIATLIAVLVVLSMTPKYKATTTILIEAEEAKVLSIE
EVYGLSSKSSEYFLTQFEILKSREMAKRVVDKLGLANKPEFNPFHPSIKKGFSLKALIFG
EGETPTEKQIQDATIDNFWSAISVSPVRKTQLVKVSVETEDKALAPIAANTVAQA
DOMAINcd541/732TSSVPAEGKTTTSLNLAAAYGQMEKVLLIDADMRRPTVAKQLRLPSGSKGLSNAVANPEI
LDECIYSLDDMKVDVIPAGFIPPNPLELLSSKNFAGLLETLKGRYQRIIIDSAPMQAVSD
ALYLSTLTDGVVYVIKSDSTKDKLIKGGLGRLDDSNARILGVVLNQVDVDKEAKYGGHYG
GYYDTYEYKASS
SITEWalker A548/550GKT
SITEWalker A'567/574LLIDADMR
SITEWalker B648/654IIIDSAP
SITEY Cluster715/728YGGHYGGYYDTYEY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MMGNKAKYQTMNDSSVEVIDLSYYWHVVRRQLKMIIALSIIATLIAVLVVLSMTPKYKATTTILIEAEEAKVLSIEEVYG
                EVIDLSYYWHVVRRQLKMIIALSIIATLIAVLVVLSMTPKYKATTTILIEAEEAKVLSIEEVYG

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LSSKSSEYFLTQFEILKSREMAKRVVDKLGLANKPEFNPFHPSIKKGFSLKALIFGEGETPTEKQIQDATIDNFWSAISV
LSSKSSEYFLTQFEILKSREMAKRVVDKLGLANKPEFNPFHPSIKKGFSLKALIFGEGETPTEKQIQDATIDNFWSAISV

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SPVRKTQLVKVSVETEDKALAPIAANTVAQAYIESQLEAKVGVTQQAADWLGDRLGGLKTKLENSERELQDFREKNNLID
SPVRKTQLVKVSVETEDKALAPIAANTVAQA                                                 

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IKGGNTLYAKELDQITEKLVDSRNNRLNIEGTYTQLQNIKQLSYENLSSLPVILKNPLIVKLRQNESTAELKVSELSKRY


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GPKHPRMIAAQSDLDAVRESVLTQMKRLASGIKQDYQVAKTQERSLEKALNEVKKKIQSLNRTEFELSEYTREVKANRSL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YNAFFKRIRETSETGDLQTANARIVDPAVLPEKPFKPKKSLIVALVMVMSVMFGIALAFLRDALDATVKNAEDVDRKLGF


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AMLGLVPMMKREKDLPDTPENAMARAFAHNGTHGFKESVRTLRTSLTLASLESPAQVLLFTSSVPAEGKTTTSLNLAAAY
                                                            TSSVPAEGKTTTSLNLAAAY
                                                                   GKT          
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GQMEKVLLIDADMRRPTVAKQLRLPSGSKGLSNAVANPEILDECIYSLDDMKVDVIPAGFIPPNPLELLSSKNFAGLLET
GQMEKVLLIDADMRRPTVAKQLRLPSGSKGLSNAVANPEILDECIYSLDDMKVDVIPAGFIPPNPLELLSSKNFAGLLET
      LLIDADMR                                                                  
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LKGRYQRIIIDSAPMQAVSDALYLSTLTDGVVYVIKSDSTKDKLIKGGLGRLDDSNARILGVVLNQVDVDKEAKYGGHYG
LKGRYQRIIIDSAPMQAVSDALYLSTLTDGVVYVIKSDSTKDKLIKGGLGRLDDSNARILGVVLNQVDVDKEAKYGGHYG
       IIIDSAP                                                            YGGHYG
       730  
....:....|..
GYYDTYEYKASS
GYYDTYEYKASS
GYYDTYEY    

© 1998-2019