BYKdb

Annotate results for A0A166Y9U5

A0A166Y9U5 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A166Y9U5
DOMAINcd414/603TSTKPAEGKSTTSLALATMLARTGKRVILIDGDMRSPSVHHLGNVANVRGVSNFLAGNDD
LSGAIFEIEDLGIAALSAGPIPPNAAELLTGARLKVLIEHLHGTYDHIVVDSPPVMGLAD
APLIASHVEGVIYAVESHGIKSSQVKTALNRLAAANAHILGAVLTKFEARRSHYGYGYEY
GYGYGREEQA
SITEWalker A421/423GKS
SITEWalker A'441/448ILIDGDMR
SITEWalker B521/527IVVDSPP
SITEY Cluster587/597YGYGYEYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFDSDEDGPAFQLENGRFPADGRVARAREAGELLLENVGIEPTRLSRLVDISFSSPDAEFSARVANAWAEQFIKMNLERK


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IQATSYGRDVLQRQLAEYKTRLNESQRQLVGYASNQEIINLPAAGAADGSSTQERSIVADDLATLNAALNEAKADRIAAE


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ARFQQAGNGGSSLEALRNDTINRLRQRRAELAAEYKQLMVRFEPGYPQAQAIESQIEELDRAIAGEEARVSNSVRNEYRQ


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ALAREQALENRVNSLKGDFLDLRRRSIQYNIYQQEVDTNRALYDGLLQRFKEIGVAAGVGVNNISIVDTANAPEKPSSPK


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLINLVVSILAGLGLGVALAIGLEQMDDAITDPSEVPRRVGLPLLGSIPKVDDKSTPREVLLDRKSDLVDAYLAVQTNLG


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FTTEHGIPRSFSVTSTKPAEGKSTTSLALATMLARTGKRVILIDGDMRSPSVHHLGNVANVRGVSNFLAGNDDLSGAIFE
             TSTKPAEGKSTTSLALATMLARTGKRVILIDGDMRSPSVHHLGNVANVRGVSNFLAGNDDLSGAIFE
                    GKS                 ILIDGDMR                                
       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IEDLGIAALSAGPIPPNAAELLTGARLKVLIEHLHGTYDHIVVDSPPVMGLADAPLIASHVEGVIYAVESHGIKSSQVKT
IEDLGIAALSAGPIPPNAAELLTGARLKVLIEHLHGTYDHIVVDSPPVMGLADAPLIASHVEGVIYAVESHGIKSSQVKT
                                        IVVDSPP                                 
       570       580       590       600       
....:....|....:....|....:....|....:....|....:..
ALNRLAAANAHILGAVLTKFEARRSHYGYGYEYGYGYGREEQAQASS
ALNRLAAANAHILGAVLTKFEARRSHYGYGYEYGYGYGREEQA    
                          YGYGYEYGYGY          
© 1998-2019