BYKdb

Annotate results for A0A167B871

A0A167B871 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A167B871
DOMAINtad27/283DTIDLSQIGDFLLRGKWLILGGLLAGVLVGGFMSWQSLPRYESSTLLQVELKSPMFALQM
DTEFVSESRGIPTEVEIMQSRMVLGRVVRELQLEVVTRPLPAPLLGRPLAAESPLVSMPG
LGPWLAPYAGYKASVEVATLEFEGFWSEQAVIIENLGDQRFAVWTADGETRLGEGQVDER
LILHHEDGQLSLRLHELQATPGARFQLRRRSELAAISDLRSRMSAGEQGRQTGLVRLSMS
AESPQAAAQMANAIANA
DOMAINcd560/753TGPRPAVGKSFIAINLGAVLSQGGARVLVIDADIRRQSLDPYLPEDHRAVGLTEYLSGSA
SSDETIINLGDTQGLLHVMGAGHLRTRAFTMMSSPRFDTLMEECRGRYDYVLIDTPPALM
FADAASLARRGLDTLIVLESSGHKMAEVEETVRRLRRAGGRVLGFVLNQYVPASLGAGYH
GYHGYSSYRYRYRY
SITEWalker A567/569GKS
SITEWalker A'587/594LVIDADIR
SITEWalker B670/676VLIDTPP
SITE-667/-669YDY
SITEY Cluster738/757YHGYHGYSSYRYRYRYGKHY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDDSSQPQENRGAVNATAASHTNDDGDTIDLSQIGDFLLRGKWLILGGLLAGVLVGGFMSWQSLPRYESSTLLQVELKSP
                          DTIDLSQIGDFLLRGKWLILGGLLAGVLVGGFMSWQSLPRYESSTLLQVELKSP

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFALQMDTEFVSESRGIPTEVEIMQSRMVLGRVVRELQLEVVTRPLPAPLLGRPLAAESPLVSMPGLGPWLAPYAGYKAS
MFALQMDTEFVSESRGIPTEVEIMQSRMVLGRVVRELQLEVVTRPLPAPLLGRPLAAESPLVSMPGLGPWLAPYAGYKAS

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VEVATLEFEGFWSEQAVIIENLGDQRFAVWTADGETRLGEGQVDERLILHHEDGQLSLRLHELQATPGARFQLRRRSELA
VEVATLEFEGFWSEQAVIIENLGDQRFAVWTADGETRLGEGQVDERLILHHEDGQLSLRLHELQATPGARFQLRRRSELA

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AISDLRSRMSAGEQGRQTGLVRLSMSAESPQAAAQMANAIANAYQRQHVERRSEQARATLAFLEQQIPGLRQDVEQSEQS
AISDLRSRMSAGEQGRQTGLVRLSMSAESPQAAAQMANAIANA                                     

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LVDFLRKEGTVDLDRDASRVLNRLVELDTRLTELSAEREELLLRLTPEHPQAQALDRQMQRLREERDRIERDVGRMPATQ


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QELLALRRENQAATEIYVNFLNTAQELEIAQAGIVGSVRIIDPAVAENRTVGAGAQRTSLIAGILGGILGVGLAFWFHAA


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GRRVYEPDSLEHHTGLPVHGVVPFSPLQRRLSREARGGGKIPVLIEVSDDDAAAEAMRSLSTSLRMARQPDAQSHVILVT
                                                                               T

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GPRPAVGKSFIAINLGAVLSQGGARVLVIDADIRRQSLDPYLPEDHRAVGLTEYLSGSASSDETIINLGDTQGLLHVMGA
GPRPAVGKSFIAINLGAVLSQGGARVLVIDADIRRQSLDPYLPEDHRAVGLTEYLSGSASSDETIINLGDTQGLLHVMGA
      GKS                 LVIDADIR                                              
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GHLRTRAFTMMSSPRFDTLMEECRGRYDYVLIDTPPALMFADAASLARRGLDTLIVLESSGHKMAEVEETVRRLRRAGGR
GHLRTRAFTMMSSPRFDTLMEECRGRYDYVLIDTPPALMFADAASLARRGLDTLIVLESSGHKMAEVEETVRRLRRAGGR
                             VLIDTPP                                            
       730       740       750       760  
....:....|....:....|....:....|....:....|..
VLGFVLNQYVPASLGAGYHGYHGYSSYRYRYRYGKHYAKRPG
VLGFVLNQYVPASLGAGYHGYHGYSSYRYRYRY         
                 YHGYHGYSSYRYRYRYGKHY     

© 1998-2019