BYKdb

Annotate results for A0A167HK82

A0A167HK82 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A167HK82
DOMAINtad25/280HEIDLLAIIGALLDRKFFIISITILCMLIGVVIATFSTPIYQATAMIQVEEKGGTVPGFD
ELGGMFESTSAAITEIELLKSRTIIGEAVDKLKLDIVVTPKLFPLIGERAFRTYIPLQDG
GLADPSFGASSYAWGGEEIDVFRFEVPSNAVGKSFTLVALENDGFELKGGDGQVFLSGKV
GEEVVNGEFKLTLKTLHARAGTEFILSKKQRLNTILGLQKAIGANEKGKDSGIIILGFLN
ANPEYAKTVLNEVAKI
DOMAINcd561/749SGPSPGVGKSFISVNLATVLAQSDKKVLIIDADMRKGYLQTQFGLKWENGLSDCLSGRID
LQAATKSTQVENLDVITRGQIPPNPSELLMHKNFSDLVEEVSAKYDLVIIDTPPILAVTD
PAIVSAHAGSTLLVTRFGQNHVKELELTRNRFEQNGIDVKGVVFNGVVKKASNAYGYYGY
YNYEYKSDK
SITEWalker A568/570GKS
SITEWalker A'588/595LIIDADMR
SITEWalker B668/674VIIDTPP
SITEY Cluster735/745YGYYGYYNYEY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKESMNAQSNLAAGMQDKQASQQPHEIDLLAIIGALLDRKFFIISITILCMLIGVVIATFSTPIYQATAMIQVEEKGGTV
                        HEIDLLAIIGALLDRKFFIISITILCMLIGVVIATFSTPIYQATAMIQVEEKGGTV

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PGFDELGGMFESTSAAITEIELLKSRTIIGEAVDKLKLDIVVTPKLFPLIGERAFRTYIPLQDGGLADPSFGASSYAWGG
PGFDELGGMFESTSAAITEIELLKSRTIIGEAVDKLKLDIVVTPKLFPLIGERAFRTYIPLQDGGLADPSFGASSYAWGG

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EEIDVFRFEVPSNAVGKSFTLVALENDGFELKGGDGQVFLSGKVGEEVVNGEFKLTLKTLHARAGTEFILSKKQRLNTIL
EEIDVFRFEVPSNAVGKSFTLVALENDGFELKGGDGQVFLSGKVGEEVVNGEFKLTLKTLHARAGTEFILSKKQRLNTIL

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GLQKAIGANEKGKDSGIIILGFLNANPEYAKTVLNEVAKIYVHRNVERNSAEAQKSLDFLEYQLPQVKKQLEASEQRLND
GLQKAIGANEKGKDSGIIILGFLNANPEYAKTVLNEVAKI                                        

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YQVKQQSVDISLETEGVLKQIVKLETRLQELELKKLELGRKFKQSHPSYQAALEQIEAVENQKRRLAGEIKGLPETQQEL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LRLTRDVQVNNEIYTLLLAKTQELDIVRAGTVGNVRIIDFAEVNVAAPVKPSKHFIVILATLIGGAIAVALVLIQRAMHK


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GIEDPNQIEALGLPVYASVPYSEYQVKLTGFAKARKGKTAKAKSILAMDNPADLSIEALRSLRTSLHFAMMEAKNNVIAI


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SGPSPGVGKSFISVNLATVLAQSDKKVLIIDADMRKGYLQTQFGLKWENGLSDCLSGRIDLQAATKSTQVENLDVITRGQ
SGPSPGVGKSFISVNLATVLAQSDKKVLIIDADMRKGYLQTQFGLKWENGLSDCLSGRIDLQAATKSTQVENLDVITRGQ
       GKS                 LIIDADMR                                             
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IPPNPSELLMHKNFSDLVEEVSAKYDLVIIDTPPILAVTDPAIVSAHAGSTLLVTRFGQNHVKELELTRNRFEQNGIDVK
IPPNPSELLMHKNFSDLVEEVSAKYDLVIIDTPPILAVTDPAIVSAHAGSTLLVTRFGQNHVKELELTRNRFEQNGIDVK
                           VIIDTPP                                              
       730       740         
....:....|....:....|....:....
GVVFNGVVKKASNAYGYYGYYNYEYKSDK
GVVFNGVVKKASNAYGYYGYYNYEYKSDK
              YGYYGYYNYEY    

© 1998-2019