BYKdb

Annotate results for A0A167HVD6

A0A167HVD6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A167HVD6
DOMAINcd104/280TSPSVESGKTVVAINLAMSIAQQTNRTALLVDFDLRRPSVARYLGLKRPLSLNDYLDGQV
GIAEAMVNPGVERLVVLPTNSPVFGASEVLSSDKVGNLISELRERYSDRIVIFDLPPVLA
ADDVMTVLPRIDCVLMVVASGVSTQNEVEEAMNRLSKADLLGVVLNKDEAPTQNAYY
SITEWalker A111/113GKT
SITEWalker A'132/139LLVDFDLR
SITEWalker B214/220VIFDLPP
SITEY Cluster279/280YY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MERIKLAIKKAKDGEADSKKSDSRLLRGGRAPDPSTAGRKAESGDLGSLQYVQTAVVSLEPEHLDRHRIIAHQKAHPSSW


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AFDVLRTQVLQKMDENGWRTLAITSPSVESGKTVVAINLAMSIAQQTNRTALLVDFDLRRPSVARYLGLKRPLSLNDYLD
                       TSPSVESGKTVVAINLAMSIAQQTNRTALLVDFDLRRPSVARYLGLKRPLSLNDYLD
                              GKT                  LLVDFDLR                     
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GQVGIAEAMVNPGVERLVVLPTNSPVFGASEVLSSDKVGNLISELRERYSDRIVIFDLPPVLAADDVMTVLPRIDCVLMV
GQVGIAEAMVNPGVERLVVLPTNSPVFGASEVLSSDKVGNLISELRERYSDRIVIFDLPPVLAADDVMTVLPRIDCVLMV
                                                     VIFDLPP                    
       250       260       270       280
....:....|....:....|....:....|....:....|
VASGVSTQNEVEEAMNRLSKADLLGVVLNKDEAPTQNAYY
VASGVSTQNEVEEAMNRLSKADLLGVVLNKDEAPTQNAYY
                                      YY
© 1998-2019