BYKdb

Annotate results for A0A167IR75

A0A167IR75 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A167IR75
DOMAINcd402/591TSTRPAEGKSTTSLALATMLARSGKRVILLDGDMRSPSVHHLGNVSHDRGVSNFLAGDED
FTGSIFRMDDLGIDAMSAGPIPPNAAELLTGDRMRGLIDRLHEKYDHVIVDSPPVMGLAD
APLIAGHVEGVIYAVESHGIRSTQVKTALGRLQAAHTRVFGAVLTKFEARKAHYGYGYEY
GYGYGRDTDT
SITEWalker A409/411GKS
SITEWalker A'429/436ILLDGDMR
SITEWalker B509/515VIVDSPP
SITEY Cluster575/585YGYGYEYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTNERYSAEGRAERQREAADILLTNVTINPTRLSRLVDISMTSPDPAFSAEVANSWAENFITTNLERKVQATSYGRDALQ


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RQLTEYKERLDESQRQLVAYASDQEIVNLPSEGGNDGTNTQERPIVVDNLASLNAALNEATADRIAAEARFRRAGGGGSS


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AEALSNNAINNLRQRRAELNAEYQDLMIRFEPGYPQARAIQSQIEALDQAIAREESRVSGSVRAEYQQAEAREQALRQRV


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NALTDEYLDVRRRSIQYNIYQQEVDTNRALYDGLLQRFQELGVAAGVGVNNIAIVDTANVPERPSSPRLLINLLVSLLAG


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IGIGAALALALEQLDEAIADPSEVQRRLGLPLLGTVPKVDEEETPRDALLDRKSEMVDAYIAVQTNLAFTTEHGVPRSFS


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VTSTRPAEGKSTTSLALATMLARSGKRVILLDGDMRSPSVHHLGNVSHDRGVSNFLAGDEDFTGSIFRMDDLGIDAMSAG
 TSTRPAEGKSTTSLALATMLARSGKRVILLDGDMRSPSVHHLGNVSHDRGVSNFLAGDEDFTGSIFRMDDLGIDAMSAG
        GKS                 ILLDGDMR                                            
       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PIPPNAAELLTGDRMRGLIDRLHEKYDHVIVDSPPVMGLADAPLIAGHVEGVIYAVESHGIRSTQVKTALGRLQAAHTRV
PIPPNAAELLTGDRMRGLIDRLHEKYDHVIVDSPPVMGLADAPLIAGHVEGVIYAVESHGIRSTQVKTALGRLQAAHTRV
                            VIVDSPP                                             
       570       580       590    
....:....|....:....|....:....|....
FGAVLTKFEARKAHYGYGYEYGYGYGRDTDTKAA
FGAVLTKFEARKAHYGYGYEYGYGYGRDTDT   
              YGYGYEYGYGY         
© 1998-2019