BYKdb

Annotate results for A0A167WJG6

A0A167WJG6 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A167WJG6
DOMAINtad11/267EEIDFHQLVGTLIDNRWLIAVVTGIFLAVSIAYAMLATPVYQADALLQVEHRTPVGGVAS
ELQQLLGSSNTEAITEIALLTSRMVVGQAVDDLRLDIPVQVRRFPLVGDAISRQFRSSNS
LLLARPIWGMGRYGWGGEAISVKKFEVPDSMLNVPLTLVADSGEAYRLEDGNGDEILHGK
VGEIVEKSGFTIMVSHLRANPGTVFDIRRVPTLSAIVNLQNDLIAIEQGKDSGIIAISYQ
NEDPMLASAILRDISAA
DOMAINcd546/732TGSSPNAGKTFVASNLAAVIAQSGQRVLLVDADMRKGTAHLSLGVSAGNGLSELISGRVA
FQDAIHKNAGQENLDFLSRGCVPPNPSELLMHPRFTKIMSDVAGQYDLVIVDTPPILAVT
DAAIIGNIAGTSLMVVRFGVNQLKEVELARQRLEHNSVKVNGTIFNAVEHRVAGYMSYGH
YAYLSDK
SITEWalker A553/555GKT
SITEWalker A'573/580LLVDADMR
SITEWalker B654/660VIVDTPP
SITEY Cluster720/728YMSYGHYAY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPNDVTIKKDEEIDFHQLVGTLIDNRWLIAVVTGIFLAVSIAYAMLATPVYQADALLQVEHRTPVGGVASELQQLLGSSN
          EEIDFHQLVGTLIDNRWLIAVVTGIFLAVSIAYAMLATPVYQADALLQVEHRTPVGGVASELQQLLGSSN

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TEAITEIALLTSRMVVGQAVDDLRLDIPVQVRRFPLVGDAISRQFRSSNSLLLARPIWGMGRYGWGGEAISVKKFEVPDS
TEAITEIALLTSRMVVGQAVDDLRLDIPVQVRRFPLVGDAISRQFRSSNSLLLARPIWGMGRYGWGGEAISVKKFEVPDS

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLNVPLTLVADSGEAYRLEDGNGDEILHGKVGEIVEKSGFTIMVSHLRANPGTVFDIRRVPTLSAIVNLQNDLIAIEQGK
MLNVPLTLVADSGEAYRLEDGNGDEILHGKVGEIVEKSGFTIMVSHLRANPGTVFDIRRVPTLSAIVNLQNDLIAIEQGK

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DSGIIAISYQNEDPMLASAILRDISAAYVRQNVDRSAAEAAKSLDFVRQQLPRVKADMEKAQIALKHFQMSAKSVDLTLE
DSGIIAISYQNEDPMLASAILRDISAA                                                     

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TRSMLEQMVAVETNIQQIRLEQAVADSKFQPGHPTLKALDDQVAQLSAKKDALQNQMLSLPDAQQKLLQLTGDVEVSTQT


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YTALLAQAQQLDVARAGTVGNARIVDVPAVDTTNPVKPKRILILAIGIVVGLLFSALAVFLRQSLKRGLEDPAAIEEIGM


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PVYASVPVSERWLAMVEKKRGVSLPTGAKLLAVENPADLSIEALRSLRTSLHFARIEAKNNILMITGSSPNAGKTFVASN
                                                                 TGSSPNAGKTFVASN
                                                                        GKT     
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LAAVIAQSGQRVLLVDADMRKGTAHLSLGVSAGNGLSELISGRVAFQDAIHKNAGQENLDFLSRGCVPPNPSELLMHPRF
LAAVIAQSGQRVLLVDADMRKGTAHLSLGVSAGNGLSELISGRVAFQDAIHKNAGQENLDFLSRGCVPPNPSELLMHPRF
            LLVDADMR                                                            
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TKIMSDVAGQYDLVIVDTPPILAVTDAAIIGNIAGTSLMVVRFGVNQLKEVELARQRLEHNSVKVNGTIFNAVEHRVAGY
TKIMSDVAGQYDLVIVDTPPILAVTDAAIIGNIAGTSLMVVRFGVNQLKEVELARQRLEHNSVKVNGTIFNAVEHRVAGY
             VIVDTPP                                                           Y
       730  
....:....|..
MSYGHYAYLSDK
MSYGHYAYLSDK
MSYGHYAY    

© 1998-2019