BYKdb

Annotate results for A0A168DR31

A0A168DR31 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A168DR31
DOMAINcd45/229TSSKPSEGKSTTSANMAVAFAQSNKRVLLIDADLRKPSQHHLFGTSNRVGLTTILFKQKE
LSEVIQPTNTENLWIIHAGPTPPNPSELLSSKQMATLLSTVRGMYDVIIIDTPPILSVTD
AQIVATQSDGVVLVIDSGKVKKDVALKAKASLEHVNAKLIGVVLNNINRNESDSYSYYYG
EKNDA
SITEWalker A52/54GKS
SITEWalker A'72/79LLIDADLR
SITEWalker B152/158IIIDTPP
SITEY Cluster219/223YSYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSRLIPKKLITESYPKSPISEGYRMLRTNIEFSTIDYKLQVIMVTSSKPSEGKSTTSANMAVAFAQSNKRVLLIDADLRK
                                            TSSKPSEGKSTTSANMAVAFAQSNKRVLLIDADLRK
                                                   GKS                 LLIDADLR 
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PSQHHLFGTSNRVGLTTILFKQKELSEVIQPTNTENLWIIHAGPTPPNPSELLSSKQMATLLSTVRGMYDVIIIDTPPIL
PSQHHLFGTSNRVGLTTILFKQKELSEVIQPTNTENLWIIHAGPTPPNPSELLSSKQMATLLSTVRGMYDVIIIDTPPIL
                                                                       IIIDTPP  
       170       180       190       200       210       220         
....:....|....:....|....:....|....:....|....:....|....:....|....:....
SVTDAQIVATQSDGVVLVIDSGKVKKDVALKAKASLEHVNAKLIGVVLNNINRNESDSYSYYYGEKNDA
SVTDAQIVATQSDGVVLVIDSGKVKKDVALKAKASLEHVNAKLIGVVLNNINRNESDSYSYYYGEKNDA
                                                          YSYYY      
© 1998-2019