BYKdb

Annotate results for A0A168IKM0

A0A168IKM0 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A168IKM0
DOMAINcd47/224ASAQAGEGKTTTVSNLAIAYAQEGKKVLLIDTDLRKPLLHQVFNISNYAGLTNVLTNQYE
LQDVVRETLIDHLDVITSGPIPPNPSEMLSSRKMKTVLDEVKDLYDVILFDTPPVLAVTD
ALIVSSLCDGVILVVSTAKKGLVKKAKANLEHVNTRFLGVVLNNVTMGKEIPYYYGES
SITEWalker A54/56GKT
SITEWalker A'74/81LLIDTDLR
SITEWalker B154/160ILFDTPP
SITEY Cluster219/221YYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MRQSINKSHNLVTSIRPKSPISEAYRTLRTNILFSSVDDKIRTIMVASAQAGEGKTTTVSNLAIAYAQEGKKVLLIDTDL
                                              ASAQAGEGKTTTVSNLAIAYAQEGKKVLLIDTDL
                                                     GKT                 LLIDTDL
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RKPLLHQVFNISNYAGLTNVLTNQYELQDVVRETLIDHLDVITSGPIPPNPSEMLSSRKMKTVLDEVKDLYDVILFDTPP
RKPLLHQVFNISNYAGLTNVLTNQYELQDVVRETLIDHLDVITSGPIPPNPSEMLSSRKMKTVLDEVKDLYDVILFDTPP
R                                                                        ILFDTPP
       170       180       190       200       210       220    
....:....|....:....|....:....|....:....|....:....|....:....|....
VLAVTDALIVSSLCDGVILVVSTAKKGLVKKAKANLEHVNTRFLGVVLNNVTMGKEIPYYYGES
VLAVTDALIVSSLCDGVILVVSTAKKGLVKKAKANLEHVNTRFLGVVLNNVTMGKEIPYYYGES
                                                          YYY   
© 1998-2019