BYKdb

Annotate results for A0A168QTU8

A0A168QTU8 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A168QTU8
DOMAINcd262/451SGPTQDCGKTLVATNLAAIAGQSGQRVLFIDADMRQGYVHNIFGLENRHGLSCLLEGKRD
LAEVIQHAEKGGIDVITCGPEPLRPLELLLSERFLSVMSWVNEQYDIVIIDTPPVLAVTD
AALVARAAGTTLMVARFDKTSVKEMENTVKRLQHVGVKVSGTILNDIIKSAALYYSSGYS
QYEYGYASRK
SITEWalker A269/271GKT
SITEWalker A'289/296LFIDADMR
SITEWalker B369/375VIIDTPP
SITEY Cluster435/447YYSSGYSQYEYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPKISADLDQAEARLNAYRAQRDSVDLSLEAKSVLDQVVNVENQLNELTFREAEISQLFKKSHPTYRALHEKRQTLERER


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ERLNNRVSAMPSTQQEILRLSRDVESGRTIYLQLLTRQQELNISRSSAVGNVRIIDEAVTLPDPIKPRKALIIVLGALFG


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LMLSMGTVLVRQAFKRGITLSEQLEAQGMPVLATLPRSQWLWSKTQLRRKNPFSRRWKHKTSDVPFLPVDRPADMFVEAV


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RGLRTSLHFTMMEAENRIVMISGPTQDCGKTLVATNLAAIAGQSGQRVLFIDADMRQGYVHNIFGLENRHGLSCLLEGKR
                     SGPTQDCGKTLVATNLAAIAGQSGQRVLFIDADMRQGYVHNIFGLENRHGLSCLLEGKR
                            GKT                 LFIDADMR                        
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DLAEVIQHAEKGGIDVITCGPEPLRPLELLLSERFLSVMSWVNEQYDIVIIDTPPVLAVTDAALVARAAGTTLMVARFDK
DLAEVIQHAEKGGIDVITCGPEPLRPLELLLSERFLSVMSWVNEQYDIVIIDTPPVLAVTDAALVARAAGTTLMVARFDK
                                                VIIDTPP                         
       410       420       430       440       450      
....:....|....:....|....:....|....:....|....:....|....:.
TSVKEMENTVKRLQHVGVKVSGTILNDIIKSAALYYSSGYSQYEYGYASRKKGERR
TSVKEMENTVKRLQHVGVKVSGTILNDIIKSAALYYSSGYSQYEYGYASRK     
                                  YYSSGYSQYEYGY         
© 1998-2019