BYKdb

Annotate results for A0A171DSR6

A0A171DSR6 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A171DSR6
DOMAINtad1/136MDLRHYLRVFRAHWLGMLLLVVAAVAIAFGWTLLQPRVYTADATAIVQATASGDDVGSKM
LGNQLASSSVKTYVDLGTSRSVAERVIEELELDTTPDRLVSQVTVTNPLDTFSLKVTATA
SSPEGARDIAEAWVRG
DOMAINcd278/468TSPLPGDGKSTTASNLAITLASSGERVLLIDGDLRRPMIGKIFGLVEAVGLSEVLSGRAD
ITQVAQRIPGRDNLIVVAAGKLPPNPSEVLGSVKMRDMLQAVSREAIVIIDAPPLIPVTD
AAVLAQHADGAIIVATVGKTTFEVLGKALGNLARANARALGVVLNRVPRRGSGAAYYGYQ
YHGDYYRADSE
SITE-415/-417GKT
SITEWalker A'305/312LLIDGDLR
SITEWalker B385/391VIIDAPP
SITEY Cluster453/463YYGYQYHGDYY
SITEWalker A285/287GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDLRHYLRVFRAHWLGMLLLVVAAVAIAFGWTLLQPRVYTADATAIVQATASGDDVGSKMLGNQLASSSVKTYVDLGTSR
MDLRHYLRVFRAHWLGMLLLVVAAVAIAFGWTLLQPRVYTADATAIVQATASGDDVGSKMLGNQLASSSVKTYVDLGTSR

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SVAERVIEELELDTTPDRLVSQVTVTNPLDTFSLKVTATASSPEGARDIAEAWVRGMAAEVNLLETADEEEAGLVHLAAI
SVAERVIEELELDTTPDRLVSQVTVTNPLDTFSLKVTATASSPEGARDIAEAWVRG                        

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DSARLPESPSSPNTRLALAVGALIGMAVAFGYAMLRYTLDRRIRSVDAVEKELGIAVVGTLPEEKSFTPENRLIPQDGGN


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SANSAHAHLFAIAEAMRELRTNIQFMDVDNPPRVIVVTSPLPGDGKSTTASNLAITLASSGERVLLIDGDLRRPMIGKIF
                                     TSPLPGDGKSTTASNLAITLASSGERVLLIDGDLRRPMIGKIF
                                            GKS                 LLIDGDLR        
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GLVEAVGLSEVLSGRADITQVAQRIPGRDNLIVVAAGKLPPNPSEVLGSVKMRDMLQAVSREAIVIIDAPPLIPVTDAAV
GLVEAVGLSEVLSGRADITQVAQRIPGRDNLIVVAAGKLPPNPSEVLGSVKMRDMLQAVSREAIVIIDAPPLIPVTDAAV
                                                                VIIDAPP         
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LAQHADGAIIVATVGKTTFEVLGKALGNLARANARALGVVLNRVPRRGSGAAYYGYQYHGDYYRADSEESEEDLAPGPRR
LAQHADGAIIVATVGKTTFEVLGKALGNLARANARALGVVLNRVPRRGSGAAYYGYQYHGDYYRADSE            
                                                    YYGYQYHGDYY                 
      
....:.
RRAAVE


© 1998-2019