BYKdb

Annotate results for A0A172YSV5

A0A172YSV5 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A172YSV5
DOMAINtad9/259DTIDLKELFFSLIAQWKLIALCIILSLIAALLYLRTTPDTYSVNALVQVEENKGASAALL
GDLSGMIDQKQPAQAEIEILKSRMVLGKAIQKLNLDVVIHSKENSLISRLFNPHDYRTDY
SEHHVQFHDDLKHFDIRQFNIPQDYLNKELNLSFNQNQFSLIDPKTEQVVYKGLINQNPQ
TQGSWQVAIFTQDQISNQYTVQKRSLPAAVEHLLQEFSVAEKGKLTGILGLNLQGEDKQH
ITRVLNEILVA
DOMAINcd535/723SGPSPEVGKSFITANLGAILAQGGKKVLIIDADMRRGYLHKYFNQSTTTGLSELLLGTVS
KDEVIKKTQLDSLFFLARGKNPSNPSELLSSQKFKDLLDELSPHYDHILIDTPPTLAVTD
GVIIAQYAGVNLLIVRHAKTQLKEIEITVNRFEQANVRVNGVILNDVEYRHGYGYGYGYN
YTYGYKSNK
SITEWalker A542/544GKS
SITEWalker A'562/569LIIDADMR
SITEWalker B642/648ILIDTPP
SITE-572/-576YLHKY
SITEY Cluster703/719YRHGYGYGYGYNYTYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSQNTQTEDTIDLKELFFSLIAQWKLIALCIILSLIAALLYLRTTPDTYSVNALVQVEENKGASAALLGDLSGMIDQKQP
        DTIDLKELFFSLIAQWKLIALCIILSLIAALLYLRTTPDTYSVNALVQVEENKGASAALLGDLSGMIDQKQP

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AQAEIEILKSRMVLGKAIQKLNLDVVIHSKENSLISRLFNPHDYRTDYSEHHVQFHDDLKHFDIRQFNIPQDYLNKELNL
AQAEIEILKSRMVLGKAIQKLNLDVVIHSKENSLISRLFNPHDYRTDYSEHHVQFHDDLKHFDIRQFNIPQDYLNKELNL

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SFNQNQFSLIDPKTEQVVYKGLINQNPQTQGSWQVAIFTQDQISNQYTVQKRSLPAAVEHLLQEFSVAEKGKLTGILGLN
SFNQNQFSLIDPKTEQVVYKGLINQNPQTQGSWQVAIFTQDQISNQYTVQKRSLPAAVEHLLQEFSVAEKGKLTGILGLN

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LQGEDKQHITRVLNEILVAYNQQNVERRSAETAQTLKFLDEQLPELKTKLDIAEREFNTFRQKYNTVDVTKESELYLSQS
LQGEDKQHITRVLNEILVA                                                             

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IALETQKTQLEQKVAEASAKYTSEHPIIQQMEAQLSAINTKITELNNTLKQLPDLQRRYLQLYREVEVQQQLYTSLLNSY


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QQLRIAKAGEIGNVRIVDTAVEPIKPIKPKKLIVLVLSLFVGGFLGILLALLRNMMRSGVKDATQIENELELPVYATVPR


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SPIQESRIKNLKKKKTIPLLAIKDSNDIAIESIRSIRTTIHFALNEAKNNIIAISGPSPEVGKSFITANLGAILAQGGKK
                                                      SGPSPEVGKSFITANLGAILAQGGKK
                                                             GKS                
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLIIDADMRRGYLHKYFNQSTTTGLSELLLGTVSKDEVIKKTQLDSLFFLARGKNPSNPSELLSSQKFKDLLDELSPHYD
VLIIDADMRRGYLHKYFNQSTTTGLSELLLGTVSKDEVIKKTQLDSLFFLARGKNPSNPSELLSSQKFKDLLDELSPHYD
 LIIDADMR                                                                       
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HILIDTPPTLAVTDGVIIAQYAGVNLLIVRHAKTQLKEIEITVNRFEQANVRVNGVILNDVEYRHGYGYGYGYNYTYGYK
HILIDTPPTLAVTDGVIIAQYAGVNLLIVRHAKTQLKEIEITVNRFEQANVRVNGVILNDVEYRHGYGYGYGYNYTYGYK
 ILIDTPP                                                      YRHGYGYGYGYNYTYGY 
      
....:.
SNKSLD
SNK   

© 1998-2019